YAP1 Antibody (2F12) - Isoform 5 - Azide and BSA Free

Western Blot: YAP1 Antibody (2F12) - Isoform 5 [H00010413-M01] - YAP1 Antibody (2F12) [H00010413-M01] - JNK phosphorylation of YAP enhances the stabilization of delta-Np63alpha by direct binding. H357 cells were transfected with control siRNA (siCTL) or YAP siRNA (siYAP) and 72 h later the cells were harvested for IP of endogenous p63. p63 IP eluates and input lysates were analyzed by Western blotting using the indicated antibodies. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/cddis20107) licensed under a CC-BY license.

Western Blot: YAP1 Antibody (2F12) [H00010413-M01] - Analysis of YAP1 Antibody (2F12) Isoform 5 expression in Hela S3 N cells. Observed molecular weight 75 kDa.

Immunocytochemistry/Immunofluorescence: YAP1 Antibody (2F12) [H00010413-M01] - Analysis of monoclonal antibody to YAP1 on HeLa cell. Antibody concentration 30 ug/ml.

Immunohistochemistry-Paraffin: YAP1 Antibody (2F12) [H00010413-M01] - Analysis of monoclonal antibody to YAP1 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 3 ug/ml.

Western Blot: YAP1 Antibody (2F12) [H00010413-M01] - JNK specifically phosphorylates YAP in vivo. HaCaT, U2OS, MCF7 and 293T cell lines were treated with anisomycin or DMSO (control) for 60 min before harvesting. YAP band shift was analyzed as described before and lysates were analyzed by Western blotting with the indicated antibodies. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/cddis20107) licensed under a CC-BY license.

Western Blot: YAP1 Antibody (2F12) [H00010413-M01] - Immunogen detection using YAP1 antibody (2F12) Isoform 5, observered MW 37.73KDa) .

Western Blot: YAP1 Antibody (2F12) [H00010413-M01] - Analysis of YAP1 Antibody (2F12) Isoform 5 in transfected 293T cell line. Lane 1: YAP1 transfected lysate (TMW: 54.5 KDa, observed MW 75 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Po, Bv, Ca
• Applications: WB, ELISA, ICC/IF, IHC, IP, KD
• Clone: 2F12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

YAP1 Antibody (2F12) - Isoform 5 - Azide and BSA Free Summary

• Immunogen: YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
• Localization: Nucleoplasm, Nucleoli and cytoplasm
• Specificity: Expected cross reactivity based on immunogen sequence isoforms: Isoform 1 (100%), Isoform 2 (100%), Isoform 3 (100%), Isoform 6 (100)%, Isoform 7 (100%), Isoform 8 (100%), Isoform 9 (100%)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: YAP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 30 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 3 ug/ml
  • Immunoprecipitation 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 23791527). Use in Canine reported in scientific literature (PMID:28793266). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions. Use in Bovine reported in secitific publication PMID: 32513530

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for YAP1 Antibody (2F12) - Isoform 5 - Azide and BSA Free

• 65 kDa Yes-associated protein
• COB1
• Protein Yorkie Homolog
• Transcriptional Coactivator YAP1
• YAP
• YAP1
• YAP1-2gamma
• YAP2
• YAP2L
• YAP65
• YAP65yes-associated protein 2
• Yes Associated Protein
• Yes-associated protein 1
• Yes-associated protein 1, 65kDa
• yes-associated protein beta
• yes-associated protein delta
• Yes-Associated Protein YAP65 Homolog
• Yes-Associated Protein
• YKI
• Yorkie Homolog

Background

The transcriptional coactivator Yes-associated protein (YAP), also known as Yes-associated protein 1 (YAP1), Yes-Associated Protein YAP65 Homolog, Protein Yorkie Homolog and YAP65 has a theoretical molecular weight of 65 kDa. The YAP1 gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 shares homology with the WW domain of transcriptional co-activator with PDZ-binding motif (TAZ), which functions as a transcriptional co-activator by binding to the PPXY motif present in transcription factors and is likely involved in protein-protein interaction. YAP has been identified as a core regulatory mechanism that blocks mammalian glial cell proliferation and cellular reprogramming following damage (1).

YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).

References

1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047

2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361

3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for YAP1 Antibody (H00010413-M01)(65)

Publications using H00010413-M01

• Swarnabh B, Abhishek M, Sabrina P et al. The biophysical property of the limbal niche maintains stemness through YAP. Cell Death Differ. 2023-04-24 [PMID: 37095157]
• Claudia G, Afshan M, Gwen S et al. A conserved role of the Hippo signalling pathway in initiation of the first lineage specification event across mammals. Development. 2023-04-20 [PMID: 36971487]
• Kawaue T, Yow I, Pan Y et al. Inhomogeneous mechanotransduction defines the spatial pattern of apoptosis-induced compensatory proliferation Developmental Cell 2023-02-27 [PMID: 36800994] (Western Blot, Human)
• TMH Nguyen, YS Lai, YC Chen, TC Lin, NT Nguyen, WT Chiu Hypoxia-induced YAP activation and focal adhesion turnover to promote cell migration in mesenchymal TNBC cells Cancer Medicine, 2023-02-09;0(0):. 2023-02-09 [PMID: 36757143]
• Keisuke G, Kohei O, Tsunekazu H et al. Seborrheic Keratosis With Malignant Transformation (Invasive or Noninvasive Squamous Cell Carcinoma Arising in Seborrheic Keratosis): A Clinicopathologic and Immunohistochemical Study of 11 Cases. Am J Dermatopathol. 2022-07-06 [PMID: 36395445]
• Chen N, Golczer G, Ghose S et al. YAP1 maintains active chromatin state in head and neck squamous cell carcinomas that promotes tumorigenesis through cooperation with BRD4 Cell reports 2022-06-14 [PMID: 35705032] (ICC/IF, Human)
• Lauren S, William S, Katelin H et al. Nucleotide- and Protein-Dependent Functions of Actg1. Mol Biol Cell. 2022-05-20 [PMID: 35594181]
• Sathya S, Fernanda F, Michael E et al. HDAC11 activity contributes to MEK inhibitor escape in uveal melanoma. Cancer Gene Ther. 2022-03-24 [PMID: 35332245]
• Yutong G, Yini Q, Shuqi Q et al. Relationship of matrix stiffness and cell morphology in regulation of osteogenesis and adipogenesis of BMSCs. Mol Biol Rep. 2022-01-13 [PMID: 35023006]
• Chang CY, Shipony Z, Lin SG Et al. Increased ACTL6A occupancy within mSWI/SNF chromatin remodelers drives human squamous cell carcinoma Molecular cell 2021-10-19 [PMID: 34687603] (Western Blot, Human)
• Yan H, Yu CC, Fine SA Et al. Loss of the wild-type KRAS allele promotes pancreatic cancer progression through functional activation of YAP1 Oncogene 2021-10-18 [PMID: 34663879] (ICC/IF, Human)
• Hwang D, Kim M, Kim S Et al. AMOTL2 mono-ubiquitination by WWP1 promotes contact inhibition by facilitating LATS activation Life science alliance 2021-10-01 [PMID: 34404733] (WB, IP)
• Goswami S, Balasubramanian I, D'Agostino L et al. RAB11A-mediated YAP localization to adherens and tight junctions is essential for colonic epithelial integrity Journal of Biological Chemistry 2021-07-01 [PMID: 34058200] (Western Blot, Human)
• Brandon L, Brigitte H, Morley H et al. The RGS-RhoGEFs control the amplitude of YAP1 activation by serum. Sci Rep. 2021-01-27 [PMID: 33504879]
• Kazunari Y, Keiko M, Kana F et al. Phosphorylation and dephosphorylation of Ser852 and Ser889 control the clustering, localization and function of PAR3. J Cell Sci. 2020-11-30 [PMID: 33093242]
• Yamamura S, Goda N, Akizawa H et al. Yes-associated protein 1 translocation through actin cytoskeleton organization in trophectoderm cells Dev. Biol. 2020-09-15 [PMID: 32946790] (IF/IHC, Bovine)
• Liu Z, Wang L, Xu H et al. Heterogeneous Responses to Mechanical Force of Prostate Cancer Cells Inducing Different Metastasis Patterns Adv. Sci. 2020-06-17 [PMID: 32775149] (WB, ICC/IF, Human)
• Ourania P, Darcy K, Julia B et al. A case of YAP1 and NUTM1 rearranged porocarcinoma with corresponding immunohistochemical expression: Review of recent advances in poroma and porocarcinoma pathogenesis with potential diagnostic utility. J Cutan Pathol. 2020-08-05 [PMID: 32757412]
• Kohri N, Akizawa H, Iisaka S et al. The role of RHOA signaling in trophectoderm cell-fate decision in cattle Biochem. Biophys. Res. Commun. 2020-08-06 [PMID: 32513530] (ICC/IF, Bovine)
• Laura A, Marine L, Danahe M et al. Engineering Slit-Like Channels for Studying the Growth of Epithelial Tissues in 3D-confined Spaces. Biotechnol Bioeng. 2020-06-16 [PMID: 32484903]
• Chi F, Sharpley M, Nagaraj R et al. Glycolysis-Independent Glucose Metabolism Distinguishes TE from ICM Fate during Mammalian Embryogenesis. Dev Cell. 2020-03-19 [PMID: 32197068]
• Bora-Singhal N, Mohankumar D, Saha B et Al. Novel HDAC11 inhibitors suppress lung adenocarcinoma stem cell self-renewal and overcome drug resistance by suppressing Sox2 Sci Rep 2020-03-13 [PMID: 32170113] (Western Blot, Human)
• Emura N, Saito Y, Miura R et al. Effect of Downregulating the Hippo Pathway Members YAP1 and LATS2 Transcripts on Early Development and Gene Expression Involved in Differentiation in Porcine Embryos. Cell Reprogram. 2020-03-05 [PMID: 32150685]
• Narayanan V, Schappell L, Mayer C et al. Osmotic Gradients in Epithelial Acini Increase Mechanical Tension across E-cadherin, Drive Morphogenesis, and Maintain Homeostasis. Curr Biol. 2020-01-23 [PMID: 31983640]
• Zhang L, Noguchi YT, Nakayama H et al. The CalcR-PKA-Yap1 Axis Is Critical for Maintaining Quiescence in Muscle Stem Cells Cell Rep. 2019-11-19 [PMID: 31747590] (ICC/IF, WB, Mouse)
• Nanami Kohri, Hiroki Akizawa, Sakie Iisaka, Hanako Bai, Yojiro Yanagawa, Masashi Takahashi, Masaya Komatsu, Masahito Kawai, Masashi Nagano, Manabu Kawahara Trophectoderm regeneration to support full-term development in the inner cell mass isolated from bovine blastocyst The Journal of Biological Chemistry 2019-12-13 [PMID: 31704705]
• Bruyere C, Versaevel M, Mohammed D et al. Actomyosin contractility scales with myoblast elongation and enhances differentiation through YAP nuclear export. Sci Rep. 2019-10-29 [PMID: 31664178]
• Moriyama K, Hori T BCR-ABL induces tyrosine phosphorylation of YAP leading to expression of Survivin and Cyclin D1 in chronic myeloid leukemia cells. Int J Hematol. 2019-08-19 [PMID: 31428968]
• Kim J, Kim J, Jeong J et al. Identification of a novel embryo-prevalent gene, Gm11545, involved in preimplantation embryogenesis in mice. FASEB J. 2019-07-19 [PMID: 31322925]
• D'Agostino L, Nie Y, Goswami S et al. Recycling Endosomes in Mature Epithelia Restrain Tumorigenic Signaling Cancer Research 2019-08-15 [PMID: 31239271] (Western Blot, Human)
• Xu S, Pang L, Liu Y et al. Akt plays indispensable roles during the first cell lineage differentiation of mouse. J Mol Histol. 2019-06-13 [PMID: 31190160]
• Tran THY, Yang DW, Kim M et al. Citron kinase interacts with LATS2 and inhibits its activity by occluding its hydrophobic phosphorylation motif J Mol Cell Biol 2019-03-13 [PMID: 30865227] (IP, ICC/IF, WB, Human)
• Marikawa Y, Alarcon VB RHOA activity in expanding blastocysts is essential to regulate HIPPO-YAP signaling and to maintain the trophectoderm-specific gene expression program in a ROCK/actin filament-independent manner Mol Hum Reprod 2019-02-01 [PMID: 30395288] (IHC-P, Mouse)
• Schaal CM, Bora-Singhal N, Kumar DM, Chellappan SP et al. Regulation of Sox2 and stemness by nicotine and electronic-cigarettes in non-small cell lung cancer. Mol Cancer. 2018-10-15 [PMID: 30322398] (IP, KD, ICC/IF, WB, Human)
• Furukawa KT, Yamashita K, Sakurai N, Ohno S et al. The Epithelial Circumferential Actin Belt Regulates YAP/TAZ through Nucleocytoplasmic Shuttling of Merlin. Cell Rep 2017-08-08 [PMID: 28793266] (ICC/IF, KD, WB, Canine)
• Jang W, Kim T, Koo JS et al. Mechanical cue-induced YAP instructs Skp2-dependent cell cycle exit and oncogenic signaling EMBO J. 2017-07-03 [PMID: 28673931] (WB, ICC/IF, KD, Human)
• Sun C, De Mello V, Mohamed A et al. Common and Distinctive Functions of the Hippo Effectors Taz and Yap in Skeletal Muscle Stem Cell Function. Stem Cells. 2017-06-07 [PMID: 28589555] (IF/IHC, Mouse)
• Nagasawa-Masuda A, Terai K. Yap/Taz transcriptional activity is essential for vascular regression via Ctgf expression and actin polymerization. PLoS One. 2017-04-03 [PMID: 28369143] (IHC-P, Mouse)
• Korotkevich E, Niwayama R, Courtois A et al. The Apical Domain Is Required and Sufficient for the First Lineage Segregation in the Mouse Embryo. Dev Cell 2017-02-06 [PMID: 28171747] (IHC-P, Mouse)
• Suzuki M, Kondo A, Ogino I et al. Overexpression of TEAD4 in atypical teratoid/rhabdoid tumor: New insight to the pathophysiology of an aggressive brain tumor. Pediatr Blood Cancer. 2016-12-14 [PMID: 27966820] (IHC-P, Human)
• Junemann J, Birgin G, Erdmann J et al. Toxin A of the nosocomial pathogen Clostridium difficile induces primary effects in the proteome of HEp?2 cells. Proteomics Clin Appl. 2016-11-10 [PMID: 27860399] (WB, Human)
• Maitre JL, Turlier H, Illukkumbura R et al. Asymmetric division of contractile domains couples cell positioning and fate specification. Nature. 2016-08-18 [PMID: 27487217] (ICC/IF, Mouse)
• Abbassi L, Malki S, Cockburn K et al. Multiple Mechanisms Cooperate to Constitutively Exclude the Transcriptional Co-Activator YAP from the Nucleus During Murine Oogenesis. Biol Reprod. 2016-05-01 [PMID: 26985001] (IHC-P, ICC/IF, Mouse)
• Alarcon VB, Marikawa Y. Statins inhibit blastocyst formation by preventing geranylgeranylation. Mol Hum Reprod. 2016-05-01 [PMID: 26908642] (IF/IHC, Mouse)
• Yoyooka Y, Oka S, Fujimori T. Early preimplantation cells expressing Cdx2 exhibit plasticity of specification to TE and ICM lineages through positional changes. Dev Biol. 2016-01-21 [PMID: 26806703] (IHC-P, Mouse)
• Kim M, Kim M, Park SJ et al. Role of Angiomotin-like 2 mono-ubiquitination on YAP inhibition. EMBO Rep 2015-11-23 [PMID: 26598551] (ICC/IF, Human)
• Hirate Y, Hirahara S, Inoue K et al. Par-aPKC-dependent and -independent mechanisms cooperatively control cell polarity, Hippo signaling, and cell positioning in 16-cell stage mouse embryos. Dev Growth Differ. 2015-10-09 [PMID: 26450797] (ICC/IF, Mouse)
• Yang S, Zhang L, Purohit V et al. Active YAP promotes pancreatic cancer cell motility, invasion and tumorigenesis in a mitotic phosphorylation-dependent manner through LPAR3. Oncotarget. 2015-11-03 [PMID: 26440309] (IP, WB, KD, Human)
• Yang S, Zhang L, Chen X et al. Oncoprotein YAP Regulates the Spindle Checkpoint Activation in a Mitotic Phosphorylation-dependent Manner through Upregulation of BubR1. J Biol Chem. 2015-01-20 [PMID: 25605730] (WB, IP, Human)
• Zhao R, Fallon TR, Saladi SV et al. Yap tunes airway epithelial size and architecture by regulating the identity, maintenance, and self-renewal of stem cells. Dev Cell. 2014-07-28 [PMID: 25043474] (KD, WB, ICC/IF, IP, IF/IHC, Mouse)
• Shao Dan, Zhai Peiyong, Del Re Dominic P et al. A functional interaction between Hippo-YAP signalling and FoxO1 mediates the oxidative stress response. Nat Commun. 2014-01-01 [PMID: 24525530] (IF/IHC, Mouse)
• Adler JJ, Johnson DE, Heller BL et al. Serum deprivation inhibits the transcriptional co-activator YAP and cell growth via phosphorylation of the 130-kDa isoform of Angiomotin by the LATS1/2 protein kinases. Proc Natl Acad Sci U S A. 2013-08-19 [PMID: 24101513] (IP, WB, ICC/IF, Human)
• Yang S, Zhang L, Liu M et al. CDK1 phosphorylation of YAP promotes mitotic defects and cell motility and is essential for neoplastic transformation. Cancer Res. 2013-11-15 [PMID: 24101154] (WB, KD, IP, Human)
• Das A, Tanigawa S, Karner CM et al. Stromal-epithelial crosstalk regulates kidney progenitor cell differentiation. Nat Cell Biol. 2013-08-25 [PMID: 23974041] (WB, KD, Mouse)
• Seo E, Basu-Roy U, Gunaratne PH et al. SOX2 Regulates YAP1 to Maintain Stemness and Determine Cell Fate in the Osteo-Adipo Lineage. Cell Rep 2013-06-27 [PMID: 23791527] (ICC/IF, Mouse)
• Adler JJ, Heller BL, Bringman LR et al. Amot130 Adapts Atrophin-1 Interacting Protein 4 to Inhibit Yes-associated Protein Signaling and Cell Growth. J Biol Chem. 2013-04-05 [PMID: 23564455] (IP, WB, Human)
• Hirate Y, Cockburn K, Rossant J, Sasaki H. Tead4 is constitutively nuclear, while nuclear vs. cytoplasmic Yap distribution is regulated in preimplantation mouse embryos. Proc Natl Acad Sci U S A. 2012-12-11 [PMID: 23169672] (ICC/IF, Mouse)
• Skouloudaki K, Walz G. YAP1 Recruits c-Abl to Protect Angiomotin-Like 1 from Nedd4-Mediated Degradation. PLoS One. 2012-04-27 [PMID: 22558212] (IP, KD, WB, Canine, Human)
• Wada K, Itoga K, Okano T et al. Hippo pathway regulation by cell morphology and stress fibers. Development. 2011-08-10 [PMID: 21831922] (ICC/IF, Mouse)
• Sekido Y. Inactivation of Merlin in malignant mesothelioma cells and the Hippo signaling cascade dysregulation. Pathol Int. 2011-05-02 [PMID: 21615608] (ICC/IF, WB, Human)
• Leivonen S, Rokka A, Ostling P et al. Identification of miR-193b targets in breast cancer cells and systems biological analysis of their functional impact. Mol Cell Proteomics. 2011-04-21 [PMID: 21512034]
• Leivonen SK, Rokka A, Ostling P et al. Identification of miR-193b targets in breast cancer cells and systems biological analysis of their functional impact. Mol Cell Proteomics. 2011 Apr 21 [PMID: 21512034]
• V Tomlinson, K Gudmundsdottir, P Luong et al. JNK phosphorylates Yes-associated protein (YAP) to regulate apoptosis. Cell Death Dis. 2010-01-01 [PMID: 21364637] (IP, WB, Human)
• Murakami H, Mizuno T, Taniguchi T et al. LATS2 Is a Tumor Suppressor Gene of Malignant Mesothelioma. Cancer Res. 2011-01-18 [PMID: 21245096] (WB, ICC/IF, Human)
• Lau YK, Murray LB, Houshmandi SS et al. Merlin Is a Potent Inhibitor of Glioma Growth. Cancer Res. 2008-07-15 [PMID: 18632626] (WB, Human)

Bioinformatics

• Gene Symbol: YAP1
• Entrez:
  • 10413(Human)
  • 363014(Rat)
• OMIM:
  • 606608(Human)