Recombinant Human YAP1 GST (N-Term) Protein

SDS-Page: Recombinant Human YAP1 Protein [H00010413-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, In vitro, PA, AP

Recombinant Human YAP1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-504 of Human YAP1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: YAP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Immunocytochemistry/Immunofluorescence
  • In vitro assay
  • Protein Array
  • Western Blot
• Application Notes: Use in In vitro reported in scientific literature (PMID:33297404).
• Theoretical MW: 80.9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human YAP1 GST (N-Term) Protein

• 65 kDa Yes-associated protein
• COB1
• Protein Yorkie Homolog
• Transcriptional Coactivator YAP1
• YAP
• YAP1
• YAP1-2gamma
• YAP2
• YAP2L
• YAP65
• YAP65yes-associated protein 2
• Yes Associated Protein
• Yes-associated protein 1
• Yes-associated protein 1, 65kDa
• yes-associated protein beta
• yes-associated protein delta
• Yes-Associated Protein YAP65 Homolog
• Yes-Associated Protein
• YKI
• Yorkie Homolog

Background

The transcriptional coactivator Yes-associated protein (YAP), also known as Yes-associated protein 1 (YAP1), Yes-Associated Protein YAP65 Homolog, Protein Yorkie Homolog and YAP65 has a theoretical molecular weight of 65 kDa. The YAP1 gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 shares homology with the WW domain of transcriptional co-activator with PDZ-binding motif (TAZ), which functions as a transcriptional co-activator by binding to the PPXY motif present in transcription factors and is likely involved in protein-protein interaction. YAP has been identified as a core regulatory mechanism that blocks mammalian glial cell proliferation and cellular reprogramming following damage (1).

YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).

References

1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047

2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361

3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Publications for YAP1 Full Length Recombinant Protein (H00010413-P01)(4)

Publications using H00010413-P01

• Khalil MI, Ghosh I, Singh V et al. NEK1 Phosphorylation of YAP Promotes Its Stabilization and Transcriptional Output Cancers Dec 7 2020 [PMID: 33297404] (In vitro, Human)
• Yao F, Zhou Z, Kim J et al. SKP2- and OTUD1-regulated non-proteolytic ubiquitination of YAP promotes YAP nuclear localization and activity Nat Commun Jun 11 2018 [PMID: 29891922] (WB, Human)
• Chang Ss, Yamaguchi H, Xia W et al. Aurora A kinase activates YAP signaling in triple-negative breast cancer. Oncogene Sep 5 2016 [PMID: 27593935]
• Zhao Y, Zhou W, Xue L et al. Nicotine Activates YAP1 through nAChRs Mediated Signaling in Esophageal Squamous Cell Cancer (ESCC). PLoS One. 2014 Mar 12 [PMID: 24621512]

Review for YAP1 Full Length Recombinant Protein (H00010413-P01) (1)

Average Rating: 4

(Based on 1 review)

reviewed by: Verified Customer In-vitro kinase assay either with TLK1B or MK5 using 32P-ATP. 09/18/2020

Summary

• Application: Other
• Lot: K6191
• Comments: The protein we obtained is very clean and not degraded. It was sent in dry ice with proper packaging.

Bioinformatics

• Gene Symbol: YAP1