XPE/DDB2 Recombinant Protein Antigen

Images

 
There are currently no images for XPE/DDB2 Protein (NBP2-38854PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XPE/DDB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDB2.

Source: E. coli

Amino Acid Sequence: GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38854.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XPE/DDB2 Recombinant Protein Antigen

  • damage-specific DNA binding protein 2 (48kD)
  • damage-specific DNA binding protein 2, 48kDa
  • Damage-specific DNA-binding protein 2
  • DDB p48 subunit
  • DDB2
  • DDBB
  • DNA damage-binding protein 2
  • FLJ34321
  • UV-damaged DNA-binding protein 2
  • UV-DDB 2
  • UV-DDB2
  • xeroderma pigmentosum group E protein
  • XP5
  • XPE/DDB2

Background

DDB2, also known as DNA damage-binding protein 2, consists of five isoforms of sizes 47.9 kDa, 26.7 kDa, 17.4 kDa, 40.7 kDa, and 26.8 kDa and is involved in repairing DNA damaged by ultraviolet light. Current research is being conducted on disorders and diseases including immunodeficiency, hepatitis, multiple sclerosis, lung cancer, ovarian cancer, skin cancer, and autosomal recessive disease. The protein has been linked to DNA repair and protein stability pathways where it interacts with CUL4A, DDB1, COPS5, ABL1, and E2F1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-2267
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-84382
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3416
Species: Hu
Applications: WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF5510
Species: Hu
Applications: WB
H00009455-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-38854PEP
Species: Hu
Applications: AC

Publications for XPE/DDB2 Protein (NBP2-38854PEP) (0)

There are no publications for XPE/DDB2 Protein (NBP2-38854PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPE/DDB2 Protein (NBP2-38854PEP) (0)

There are no reviews for XPE/DDB2 Protein (NBP2-38854PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XPE/DDB2 Protein (NBP2-38854PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XPE/DDB2 Products

Research Areas for XPE/DDB2 Protein (NBP2-38854PEP)

Find related products by research area.

Blogs on XPE/DDB2

There are no specific blogs for XPE/DDB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XPE/DDB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDB2