XPC Antibody [mFluor Violet 500 SE]

• Reactivity: Hu
• Applications: WB, ELISA, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 500 SE

XPC Antibody [mFluor Violet 500 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-940 of human XPC (NP_004619.3).
  
  Sequence:
  GEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XPC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for XPC Antibody [mFluor Violet 500 SE]

• complementation group C antibody
• p125
• RAD4
• Xeroderma pigmentosum group C-complementing protein
• xeroderma pigmentosum, complementation group C
• XP3
• XPCCDNA repair protein complementing XP-C cells

Background

Human XPC (Xeroderma pigmentosum group C) is a member of a family of proteins that has been shown to be involved in the repair of DNA via the nucleotide excision repair (NER) pathway. Specifically, XPC is believed to be a part of a heteromeric protein complex that is involved in the recognition of the DNA lesions during global genomic repair but not transcription-coupled repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XPC