XPB Antibody - BSA Free

Western Blot: XPB Antibody [NBP3-10467] - Western blot analysis using NBP3-10467 on Human HCT15 as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

XPB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit XPB Antibody - BSA Free (NBP3-10467) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XPB (NP_000113). Peptide sequence MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERCC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 89 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for XPB Antibody - BSA Free

• Basic transcription factor 2 89 kDa subunit
• BTF2 p89
• BTF2
• DNA excision repair protein ERCC-3
• DNA repair protein complementing XP-B cells
• EC 3.6.1
• EC 3.6.4.12
• ERCC3
• excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing)
• GTF2H
• RAD25
• TFIIH basal transcription factor complex 89 kDa subunit
• TFIIH basal transcription factor complex helicase XPB subunit
• TFIIH p89
• TFIIH
• Xeroderma pigmentosum group B-complementing protein
• xeroderma pigmentosum, complementation group B
• XPB
• XPBC
• XPBTFIIH 89 kDa subunit

Background

ERCC3 is a component of the core TFIIH basal transcription factor and functions as an ATP-dependent 3'-5' DNA helicase. ERCC3 is involved in nucleotide excision repair and is the cause of xeroderma pigmentosum complementation group B (XPB), also known as xeroderma pigmentosum II (XP2). Additionally, it has been found to be the cuase of Cockayne syndrome, and trichothiodystrophy (TTD). XPB is an autosomal recessive disease characterized by skin photosensitivity and a predisposition to skin cancer, and neurological abnormalities. Cockayne syndrome and TTD are similarly characterized by photosensitivity and neural abnormalities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERCC3