XK X-linked Kx blood group Antibody - BSA Free

Analysis in human cell line HEL.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

XK X-linked Kx blood group Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  XK X-linked Kx blood group Protein (NBP1-87828PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for XK X-linked Kx blood group Antibody - BSA Free

• Kell blood group precursor (McLeod phenotype)
• Kell complex 37 kDa component
• Kx antigen
• Kx
• membrane transport protein XK
• X1k
• XK, Kell blood group complex subunit (McLeod syndrome)
• XKR1XK-related protein 1
• X-linked Kx blood group (McLeod syndrome)
• XRG1

Background

This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XK