XK X-linked Kx blood group Antibody


Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human cell line U-2 OS shows positivity in mitochondria and vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

XK X-linked Kx blood group Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
XK X-linked Kx blood group Protein (NBP1-87828PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for XK X-linked Kx blood group Antibody

  • Kell blood group precursor (McLeod phenotype)
  • Kell complex 37 kDa component
  • Kx antigen
  • Kx
  • membrane transport protein XK
  • X1k
  • XK, Kell blood group complex subunit (McLeod syndrome)
  • XKR1XK-related protein 1
  • X-linked Kx blood group (McLeod syndrome)
  • XRG1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Bv
Applications: WB, ELISA, IP
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
Species: Hu
Applications: ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for XK X-linked Kx blood group Antibody (NBP1-87828) (0)

There are no publications for XK X-linked Kx blood group Antibody (NBP1-87828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XK X-linked Kx blood group Antibody (NBP1-87828) (0)

There are no reviews for XK X-linked Kx blood group Antibody (NBP1-87828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for XK X-linked Kx blood group Antibody (NBP1-87828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional XK X-linked Kx blood group Products

Bioinformatics Tool for XK X-linked Kx blood group Antibody (NBP1-87828)

Discover related pathways, diseases and genes to XK X-linked Kx blood group Antibody (NBP1-87828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XK X-linked Kx blood group Antibody (NBP1-87828)

Discover more about diseases related to XK X-linked Kx blood group Antibody (NBP1-87828).

Pathways for XK X-linked Kx blood group Antibody (NBP1-87828)

View related products by pathway.

PTMs for XK X-linked Kx blood group Antibody (NBP1-87828)

Learn more about PTMs related to XK X-linked Kx blood group Antibody (NBP1-87828).

Research Areas for XK X-linked Kx blood group Antibody (NBP1-87828)

Find related products by research area.

Blogs on XK X-linked Kx blood group

There are no specific blogs for XK X-linked Kx blood group, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our XK X-linked Kx blood group Antibody and receive a gift card or discount.


Gene Symbol XK