WSB1 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

WSB1 Partial Recombinant Protein Summary

Description
WSB1 (Human) GST-Tagged Recombinant Protein (Q02)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG
Preparation
Method
in vitro wheat germ expression system
Gene
WSB1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WSB1 Partial Recombinant Protein

  • DKFZp564B0482
  • SOCS box-containing WD protein SWiP-1
  • SWIP1DKFZp564A122
  • WD repeat and SOCS box containing 1
  • WD repeat and SOCS box-containing 1
  • WD repeat and SOCS box-containing protein 1
  • WSB-1

Background

This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89462
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30367
Species: Hu
Applications: WB, IP
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14200
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
H00026118-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for WSB1 Partial Recombinant Protein (H00026118-Q02) (0)

There are no publications for WSB1 Partial Recombinant Protein (H00026118-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WSB1 Partial Recombinant Protein (H00026118-Q02) (0)

There are no reviews for WSB1 Partial Recombinant Protein (H00026118-Q02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WSB1 Partial Recombinant Protein (H00026118-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WSB1 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for WSB1 Partial Recombinant Protein (H00026118-Q02)

Discover related pathways, diseases and genes to WSB1 Partial Recombinant Protein (H00026118-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WSB1 Partial Recombinant Protein (H00026118-Q02)

Discover more about diseases related to WSB1 Partial Recombinant Protein (H00026118-Q02).
 

Pathways for WSB1 Partial Recombinant Protein (H00026118-Q02)

View related products by pathway.

PTMs for WSB1 Partial Recombinant Protein (H00026118-Q02)

Learn more about PTMs related to WSB1 Partial Recombinant Protein (H00026118-Q02).
 

Research Areas for WSB1 Partial Recombinant Protein (H00026118-Q02)

Find related products by research area.

Blogs on WSB1

There are no specific blogs for WSB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol WSB1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00026118-Q02 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

WSB1 Antibody
NBP1-84162
WSB1 Antibody
NBP1-84162
WSB1 Antibody
NBP1-84162
DIO2 Antibody
NBP1-00178
DIO2 Antibody
NBP1-00178