Recombinant Human WSB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WSB1 Protein Summary

Description
WSB1 (Human) GST-Tagged Recombinant Protein (Q02)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG
Protein/Peptide Type
Partial Recombinant Protein
Gene
WSB1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WSB1 Protein

  • DKFZp564B0482
  • SOCS box-containing WD protein SWiP-1
  • SWIP1DKFZp564A122
  • WD repeat and SOCS box containing 1
  • WD repeat and SOCS box-containing 1
  • WD repeat and SOCS box-containing protein 1
  • WSB-1

Background

This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-30367
Species: Hu
Applications: WB, IP
596-MR
Species: Mu
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
594-ML/CF
Species: Mu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14200
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P

Publications for WSB1 Partial Recombinant Protein (H00026118-Q02) (0)

There are no publications for WSB1 Partial Recombinant Protein (H00026118-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WSB1 Partial Recombinant Protein (H00026118-Q02) (0)

There are no reviews for WSB1 Partial Recombinant Protein (H00026118-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WSB1 Partial Recombinant Protein (H00026118-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WSB1 Products

Bioinformatics Tool for WSB1 Partial Recombinant Protein (H00026118-Q02)

Discover related pathways, diseases and genes to WSB1 Partial Recombinant Protein (H00026118-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WSB1 Partial Recombinant Protein (H00026118-Q02)

Discover more about diseases related to WSB1 Partial Recombinant Protein (H00026118-Q02).
 

Pathways for WSB1 Partial Recombinant Protein (H00026118-Q02)

View related products by pathway.

PTMs for WSB1 Partial Recombinant Protein (H00026118-Q02)

Learn more about PTMs related to WSB1 Partial Recombinant Protein (H00026118-Q02).
 

Research Areas for WSB1 Partial Recombinant Protein (H00026118-Q02)

Find related products by research area.

Blogs on WSB1

There are no specific blogs for WSB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WSB1 Antibody
NBP1-84162
WSB1 Antibody
NBP1-84162
WSB1 Antibody
NBP1-84162
IL-21
594-ML-010/CF
IL-21
594-ML-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WSB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WSB1