WRCH1 Antibody - Azide and BSA Free

Western Blot: WRCH1 Antibody [NBP2-93157] - Analysis of extracts of U-87MG cells, using WRCH1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 15s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WRCH1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit WRCH1 Antibody - Azide and BSA Free (NBP2-93157) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human WRCH1 (NP_067028.1). GRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHOU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for WRCH1 Antibody - Azide and BSA Free

• ARHU
• CDC42L1GTP-binding protein-like 1
• DJ646B12.2
• fJ646B12.2
• FLJ10616,2310026M05Rik
• G28K
• GTP-binding protein like 1
• GTP-binding protein SB128
• hG28K
• ras homolog gene family, member U
• ras-like gene family member U
• Rho GTPase-like protein ARHU
• rho-related GTP-binding protein RhoU
• Ryu GTPase
• Wnt-1 responsive Cdc42 homolog 1
• WRCH-1
• WRCH1CDC42-like GTPase 1

Background

Function: Acts upstream of PAK1 to regulate the actin cytoskeleton, adhesion turnover and increase cell migration. Stimulates quiescent cells to reenter the cell cycle. Has no detectable GTPase activity but its high intrinsic guanine nucleotide exchange activity suggests it is constitutively GTP-bound.; Subcellular location: Cell membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor. Cell junction > focal adhesion. Cell projection > podosome. Note: Localizes to podosomes in SRC-transformed cells.; Tissue specificity: Ubiquitously expressed in all tissues examined. Expressed at high levels in the stomach, small intestine, brain, skeletal muscle and placenta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: RHOU