Reactivity | Hu, MuSpecies Glossary |
Applications | WB, Func |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | WNT7B (NP_478679.1, 1 a.a. - 349 a.a.) full-length human protein. MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
Specificity | WNT7B - wingless-type MMTV integration site family, member 7B, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | WNT7B |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00007477-B01P | Applications | Species |
---|---|---|
Seishima R, Leung C, Yada S et al. Neonatal Wnt-dependent Lgr5 positive stem cells are essential for uterine gland development. Nat Commun. 2019-11-26 [PMID: 31772170] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Wnt-7b Antibody (H00007477-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | WNT7B |
Entrez |
|
Uniprot |
|