Wnt-7b Antibody

Images

 
Western Blot: Wnt-7b Antibody [H00007477-B01P] - Analysis of WNT7B expression in transfected 293T cell line by WNT7B polyclonal antibody. Lane 1: WNT7B transfected lysate(38.39 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Func
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Wnt-7b Antibody Summary

Immunogen
WNT7B (NP_478679.1, 1 a.a. - 349 a.a.) full-length human protein. MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Specificity
WNT7B - wingless-type MMTV integration site family, member 7B,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
WNT7B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Functional
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Wnt-7b Antibody

  • protein Wnt-7b
  • wingless-type MMTV integration site family, member 7B
  • Wnt7b
  • Wnt-7b

Background

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF475
Species: Mu
Applications: WB, IHC
NBP2-46367
Species: Hu
Applications: WB, IHC
NBP2-75713
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20913
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3464
Species: Hu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
7196-WN/CF
Species: Hu
3669-WN/CF
Species: Mu
6179-WN/CF
Species: Hu
AF4109
Species: Hu
Applications: WB, IHC
AF3157
Species: Hu
Applications: WB, IHC
AF3367
Species: Hu, Mu
Applications: WB
NBP1-76916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6646
Species: Hu
Applications: WB
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-59564
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
H00007477-B01P
Species: Hu, Mu
Applications: WB, Func

Publications for Wnt-7b Antibody (H00007477-B01P) (0)

There are no publications for Wnt-7b Antibody (H00007477-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-7b Antibody (H00007477-B01P) (0)

There are no reviews for Wnt-7b Antibody (H00007477-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-7b Antibody (H00007477-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Wnt-7b Products

Bioinformatics Tool for Wnt-7b Antibody (H00007477-B01P)

Discover related pathways, diseases and genes to Wnt-7b Antibody (H00007477-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-7b Antibody (H00007477-B01P)

Discover more about diseases related to Wnt-7b Antibody (H00007477-B01P).
 

Pathways for Wnt-7b Antibody (H00007477-B01P)

View related products by pathway.

PTMs for Wnt-7b Antibody (H00007477-B01P)

Learn more about PTMs related to Wnt-7b Antibody (H00007477-B01P).
 

Research Areas for Wnt-7b Antibody (H00007477-B01P)

Find related products by research area.

Blogs on Wnt-7b

There are no specific blogs for Wnt-7b, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-7b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT7B
Entrez
Uniprot