Wnt-7b Antibody Summary
Immunogen |
WNT7B (NP_478679.1, 1 a.a. - 349 a.a.) full-length human protein. MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
Specificity |
WNT7B - wingless-type MMTV integration site family, member 7B, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
WNT7B |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody reactive against mammalian transfected lysate.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Wnt-7b Antibody
Background
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, WB
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: WB
Species: Bt, Bv, Ca, Hu, Pm, Pm, Rb
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: WB, Func
Publications for Wnt-7b Antibody (H00007477-B01P) (0)
There are no publications for Wnt-7b Antibody (H00007477-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Wnt-7b Antibody (H00007477-B01P) (0)
There are no reviews for Wnt-7b Antibody (H00007477-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Wnt-7b Antibody (H00007477-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Wnt-7b Products
Bioinformatics Tool for Wnt-7b Antibody (H00007477-B01P)
Discover related pathways, diseases and genes to Wnt-7b Antibody (H00007477-B01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Wnt-7b Antibody (H00007477-B01P)
Discover more about diseases related to Wnt-7b Antibody (H00007477-B01P).
| | Pathways for Wnt-7b Antibody (H00007477-B01P)
View related products by pathway.
|
PTMs for Wnt-7b Antibody (H00007477-B01P)
Learn more about PTMs related to Wnt-7b Antibody (H00007477-B01P).
| | Research Areas for Wnt-7b Antibody (H00007477-B01P)
Find related products by research area.
|
Blogs on Wnt-7b