Wnt-7b Antibody - Azide and BSA Free

Western Blot: Wnt-7b Antibody [H00007477-B01P] - Analysis of WNT7B expression in transfected 293T cell line by WNT7B polyclonal antibody. Lane 1: WNT7B transfected lysate(38.39 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB, Func
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Wnt-7b Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: WNT7B (NP_478679.1, 1 a.a. - 349 a.a.) full-length human protein. MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
• Specificity: WNT7B - wingless-type MMTV integration site family, member 7B,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: WNT7B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Functional
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Wnt-7b Antibody - Azide and BSA Free

• protein Wnt-7b
• wingless-type MMTV integration site family, member 7B
• Wnt7b
• Wnt-7b

Background

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Wnt-7b Antibody (H00007477-B01P)(1)

Publication using H00007477-B01P

• Seishima R, Leung C, Yada S et al. Neonatal Wnt-dependent Lgr5 positive stem cells are essential for uterine gland development. Nat Commun. 2019-11-26 [PMID: 31772170]

Bioinformatics

• Gene Symbol: WNT7B
• Entrez:
  • 7477(Human)
• Uniprot:
  • NP_478679.1(Human)