Wnt-10b Recombinant Protein Antigen

Images

 
There are currently no images for Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Wnt-10b Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Wnt-10b.

Source: E. coli

Amino Acid Sequence: SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WNT10B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56449.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Wnt-10b Recombinant Protein Antigen

  • protein Wnt-10b
  • Protein Wnt-12
  • SHFM6WNT-10B protein
  • wingless-type MMTV integration site family, member 10B
  • Wnt10b
  • Wnt-10b
  • WNT12
  • Wnt-12

Background

Researchers have indicated that they want access to novel target antibodies quickly to aid in their research. Novus is pleased to offer researchers access to products that are not fully characterized or validated. This antibody is shown by Peptide ELISA to bind to the peptide used as immunogen. Investigators should empirically determine the suitability of the antibody, including optimal dilutions, for other applications of interest. * We cannot guarantee that this antibody will work in any application other than in a Peptide ELISA against the peptide used as immunogen and therefore can not offer a refund if the antibody does not work in your application. * The antibody is offered at a lower price compared to more highly validated antibodies. * We are not able to provide the peptide used as immunogen for this product. As this antibody is not fully validated we appreciate your feedback. Customer feedback is used to help generate testing methodologies which can lead to further product validation or withdrawal.__________________________ Wnts comprise a family of secreted signaling proteins that regulate diverse developmental processes. Activation of Wnt signaling by Wnt10b inhibits differentiation of preadipocytes and blocks adipose tissue development. In bone development, Wnt10b shifts cell fate toward the osteoblast lineage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
5036-WN
Species: Hu
Applications: BA, BA
AF3900
Species: Hu, Mu
Applications: ICC, WB
645-WN
Species: Hu, Mu
Applications: BA
NBP2-46367
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
3669-WN/CF
Species: Mu
Applications: BA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-76916
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3460
Species: Hu
Applications: IHC
AF4109
Species: Hu
Applications: IHC, WB
7347-WN
Species: Hu
Applications: BA
6179-WN
Species: Hu
Applications: BA
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
AF3157
Species: Hu
Applications: IHC, WB
AF475
Species: Mu
Applications: IHC, WB
5396-SF
Species: Hu
Applications: BA
5439-DK
Species: Hu
Applications: BA
AF3464
Species: Hu
Applications: IHC, WB
NBP2-56449PEP
Species: Hu
Applications: AC

Publications for Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP) (0)

There are no publications for Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP) (0)

There are no reviews for Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Wnt-10b Products

Research Areas for Wnt-10b Recombinant Protein Antigen (NBP2-56449PEP)

Find related products by research area.

Blogs on Wnt-10b

There are no specific blogs for Wnt-10b, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Wnt-10b Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT10B