WHSC1 Antibody - BSA Free

Immunohistochemistry: WHSC1 Antibody [NBP3-38487] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using WHSC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: WHSC1 Antibody [NBP3-38487] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using WHSC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: WHSC1 Antibody [NBP3-38487] - Western blot analysis of various lysates using WHSC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WHSC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WHSC1 Antibody - BSA Free (NBP3-38487) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human WHSC1 (NP_579877.1).
  
  Sequence:
  MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 152 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WHSC1 Antibody - BSA Free

• EC 2.1.1.43
• FLJ23286
• IL5 promoter REII region-binding protein
• KIAA1090
• MGC176638
• MMSETNSD2Multiple myeloma SET domain-containing protein
• multiple myeloma SET domain containing protein type III
• nuclear receptor binding SET domain protein 2
• Nuclear SET domain-containing protein 2
• probable histone-lysine N-methyltransferase NSD2
• Protein trithorax-5
• REIIBP
• trithorax/ash1-related protein 5
• TRX5
• WHS
• Wolf-Hirschhorn syndrome candidate 1 protein
• Wolf-Hirschhorn syndrome candidate 1

Background

WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NSD2