WFDC5 Antibody

Images

 
Western Blot: WFDC5 Antibody [NBP1-57932] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Po, Bv, GPSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WFDC5 Antibody Summary

Immunogen
Synthetic peptides corresponding to WFDC5(WAP four-disulfide core domain 5) The peptide sequence was selected from the N terminal of WFDC5. Peptide sequence MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WFDC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against WFDC5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WFDC5 Antibody

  • dJ211D12.5
  • PRG5protease inhibitor WAP1
  • Putative protease inhibitor WAP1
  • WAP four-disulfide core domain 5
  • WAP four-disulfide core domain protein 5
  • WAP1p53-responsive gene 5 protein

Background

WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-51521
Species: Hu
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-66883
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38636
Species: Hu
Applications: IHC, IHC-P
NBP2-78434
Species: Hu
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87570
Species: Hu
Applications: IHC, IHC-P
NBP1-90176
Species: Hu
Applications: WB, IHC, IHC-P

Publications for WFDC5 Antibody (NBP1-57932) (0)

There are no publications for WFDC5 Antibody (NBP1-57932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WFDC5 Antibody (NBP1-57932) (0)

There are no reviews for WFDC5 Antibody (NBP1-57932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WFDC5 Antibody (NBP1-57932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WFDC5 Products

Bioinformatics Tool for WFDC5 Antibody (NBP1-57932)

Discover related pathways, diseases and genes to WFDC5 Antibody (NBP1-57932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WFDC5 Antibody (NBP1-57932)

Discover more about diseases related to WFDC5 Antibody (NBP1-57932).
 

Pathways for WFDC5 Antibody (NBP1-57932)

View related products by pathway.

Blogs on WFDC5

There are no specific blogs for WFDC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WFDC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WFDC5