Recombinant Human WDR82 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human WDR82 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-137 of Human TMEM113 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPSLPTTNCVHSLQMIPPLSPAPNQELVLGLCYMSYLAFLYMTFDFCCLYFSTVYAPSFKYICVHTDTHICVCVCIYLSSVVSKSSAEADGVLQPRRHPASLLIVFATSISESSLLIFSFQKTEAKLIVFAVSLAAK

Protein/Peptide Type
Recombinant Protein
Gene
WDR82

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WDR82 Protein

  • MST107
  • MSTP107
  • PRO2730
  • PRO34047
  • SWD2
  • TMEM113
  • WD repeat domain 82
  • WD repeat-containing protein 82
  • WDR82Atransmembrane protein 113

Background

TMEM113 is a component of the mammalian SET1A (MIM 611052)/SET1B (MIM 611055) histone H3-Lys4 methyltransferase complexes (Lee and Skalnik, 2005 [PubMed 16253997]; Lee et al., 2007 [PubMed 17355966]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
AF21581
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NB100-2242
Species: Hu, Mu
Applications: WB, ChIP, IP
NB100-56633
Species: Hu
Applications: WB
NB600-248
Species: Hu
Applications: WB, IP
NBP1-88433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56630
Species: Hu
Applications: WB
NBP1-28684
Species: Hu
Applications: IHC-P, IP
H00000904-Q01
Species: Hu
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
MAB342
Species: Hu
Applications: WB, AgAct
NB110-61626
Species: Hu
Applications: WB, IHC-P, IP
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-28684
Species: Hu
Applications: IHC-P, IP
H00080335-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for WDR82 Recombinant Protein (H00080335-P01) (0)

There are no publications for WDR82 Recombinant Protein (H00080335-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR82 Recombinant Protein (H00080335-P01) (0)

There are no reviews for WDR82 Recombinant Protein (H00080335-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR82 Recombinant Protein (H00080335-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR82 Products

Bioinformatics Tool for WDR82 Recombinant Protein (H00080335-P01)

Discover related pathways, diseases and genes to WDR82 Recombinant Protein (H00080335-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for WDR82 Recombinant Protein (H00080335-P01)

View related products by pathway.

PTMs for WDR82 Recombinant Protein (H00080335-P01)

Learn more about PTMs related to WDR82 Recombinant Protein (H00080335-P01).

Blogs on WDR82

There are no specific blogs for WDR82, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WDR82 Antibody
NBP2-57428

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WDR82 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR82