WDR79 Antibody - Azide and BSA Free

Western Blot: WDR79 Antibody [NBP3-15968] - Western blot analysis of extracts of Mouse kidney, using WDR79 antibody (NBP3-15968) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WDR79 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit WDR79 Antibody - Azide and BSA Free (NBP3-15968) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 62-160 of human WDR79 (NP_060551.2). AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WRAP53
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for WDR79 Antibody - Azide and BSA Free

• FLJ10385
• TCAB1WDR79telomerase Cajal body protein 1
• WD repeat containing, antisense to TP53
• WD repeat domain 79
• WD repeat-containing protein 79
• WD40 protein Wrap53
• WD40 repeat-containing protein encoding RNA antisense to p53
• WD-encoding RNA antisense to p53

Background

WD-repeat domain 79 (WDR79) contains six WD (tryptophan-aspartate) repeat domains found in a number of proteins that function as adaptor molecules in signal transduction and cytoskeletal organization. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. The function of the WDR79 protein has not been characterized, however significant and consistent single nucleotide polymorphisms in the WDR79 gene have been found to be associated with ER negative breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: WRAP53