WDR74 Antibody - BSA Free

Western Blot: WDR74 Antibody [NBP2-38411] - Analysis in control (vector only transfected HEK293T lysate) and WDR74 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: WDR74 Antibody [NBP2-38411] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.

Immunohistochemistry: WDR74 Antibody [NBP2-38411] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR74 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WDR74 Antibody - BSA Free (NBP2-38411) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEID
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR74
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WDR74 Protein (NBP2-38411PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR74 Antibody - BSA Free

• FLJ10439
• FLJ21730
• NOP seven-associated protein 1
• NSA1
• WD repeat domain 74
• WD repeat-containing protein 74

Background

WDR74, also known as WD repeat-containing protein 74, has a 385 amino acid long isoform that is 42 kDa and a short 366 amino acid isoform that is approx. 40 kDa, is located in the nucleolus and known to be required for RNA transcription, processing and/or stability during pre-implantation development and blastocyst formation in mouse. It is associated with Jervell and Lange-Nielsen syndrome, Jacobsen syndrome and Niemann-Pick disease. This protein has also shown to have an interaction with RGS2, CALR and NUDT3 in blastocyst formation, biological and RNA metabolic processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR74
• Uniprot:
  • Q6RFH5(Human)