WDR72 Antibody

Images

 
Immunohistochemistry-Paraffin: WDR72 Antibody [NBP2-31676] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: WDR72 Antibody [NBP2-31676] - Staining of human salivary gland shows moderate to strong nuclear positivity in acinar cells.
Immunohistochemistry-Paraffin: WDR72 Antibody [NBP2-31676] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: WDR72 Antibody [NBP2-31676] - Staining of human thyroid gland shows moderate to strong nuclear positivity in follicular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR72 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR72
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR72 Protein (NBP2-31676PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%), Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR72 Antibody

  • AI2A3
  • FLJ38736
  • MGC126663
  • MGC126665
  • WD repeat domain 72
  • WD repeat-containing protein 72

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB35661
Species: Hu
Applications: IHC, IP, Neut, WB
H00010117-Q01
Species: Hu
Applications: ELISA, Func, AP, PA, WB
NBP2-15373
Species: Hu, Mu
Applications: WB
NBP1-93737
Species: Hu, Rt
Applications: IHC, IHC-P, WB
MAB1142
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-62322
Species: Hu
Applications: WB
AF3026
Species: Mu
Applications: WB
NBP1-69078
Species: Mu
Applications: WB
NBP1-47790
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-86096
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-42216
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86019
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94138
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-93502
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-87446
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-86378
Species: Hu
Applications: WB
DVE00
Species: Hu
Applications: ELISA
NBP2-31676
Species: Hu
Applications: IHC, IHC-P

Publications for WDR72 Antibody (NBP2-31676) (0)

There are no publications for WDR72 Antibody (NBP2-31676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR72 Antibody (NBP2-31676) (0)

There are no reviews for WDR72 Antibody (NBP2-31676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WDR72 Antibody (NBP2-31676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR72 Products

Bioinformatics Tool for WDR72 Antibody (NBP2-31676)

Discover related pathways, diseases and genes to WDR72 Antibody (NBP2-31676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR72 Antibody (NBP2-31676)

Discover more about diseases related to WDR72 Antibody (NBP2-31676).
 

Pathways for WDR72 Antibody (NBP2-31676)

View related products by pathway.

Blogs on WDR72

There are no specific blogs for WDR72, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR72 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR72
Uniprot