FAM83H Antibody

Western Blot: FAM83H Antibody [NBP1-93737] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: FAM83H Antibody [NBP1-93737] - Analysis in human skin and skeletal muscle tissues using NBP1-93737 antibody. Corresponding FAM83H RNA-seq data are presented for the same tissues.

Western Blot: FAM83H Antibody [NBP1-93737] - Analysis in human cell line MCF-7.

Immunohistochemistry-Paraffin: FAM83H Antibody [NBP1-93737] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: FAM83H Antibody [NBP1-93737] - Staining of human skin shows high expression.

• Reactivity: Hu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAM83H Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM83H
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAM83H Protein (NBP1-93737PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM83H Antibody

• family with sequence similarity 83, member H
• protein FAM83H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM83H Antibody (NBP1-93737)(1)

Publication using NBP1-93737

• Qin r, Zhou M, Pan S et al. LncRNA FAM83H-AS1 promotes malignant progression of pancreatic ductal adenocarcinoma by stabilizing FAM83H mRNA to protect beta-catenin from degradation Research Square 2022-04-25 (ICC/IF)

Bioinformatics

• Gene Symbol: FAM83H