WDR7 Antibody

Images

 
Western Blot: WDR7 Antibody [NBP2-86378] - Host: Rabbit. Target Name: WDR7. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: WDR7 Antibody [NBP2-86378] - Host: Rabbit. Target Name: WDR7. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 3ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDR7. Peptide sequence: LYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
WDR7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR7 Antibody

  • TRAG
  • WDR7 WD repeat domain 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NB100-41371
Species: Rt, Ma
Applications: Flow, IHC, IHC-P, PEP-ELISA
NB100-178
Species: Hu, Mu(-)
Applications: WB, ICC/IF
NBP1-59631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-79724
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PA
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58076
Species: Hu
Applications: ICC/IF
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
NBP1-84047
Species: Hu
Applications: WB, IHC, IHC-P
7559-ST
Species: Hu
NBP1-88331
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24686
Species: Hu, Mu, Rt, Bv, Ma-Op, Pm
Applications: WB, IHC, IHC-P

Publications for WDR7 Antibody (NBP2-86378) (0)

There are no publications for WDR7 Antibody (NBP2-86378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR7 Antibody (NBP2-86378) (0)

There are no reviews for WDR7 Antibody (NBP2-86378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR7 Antibody (NBP2-86378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR7 Products

Array NBP2-86378

Bioinformatics Tool for WDR7 Antibody (NBP2-86378)

Discover related pathways, diseases and genes to WDR7 Antibody (NBP2-86378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR7 Antibody (NBP2-86378)

Discover more about diseases related to WDR7 Antibody (NBP2-86378).
 

Pathways for WDR7 Antibody (NBP2-86378)

View related products by pathway.

Blogs on WDR7

There are no specific blogs for WDR7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR7