WDR62 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WDR62 Antibody [NBP2-48788] - Staining of human cell line U-2 OS shows localization to microtubule organizing center. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: WDR62 Antibody [NBP2-48788] - Staining in human testis and liver tissues using anti-WDR62 antibody. Corresponding WDR62 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: WDR62 Antibody [NBP2-48788] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: WDR62 Antibody [NBP2-48788] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

WDR62 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YVSTPSEIHSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRLLGDDDVADGSAFHAKRSYQPHGRWAERAGQEPLKTILD
Specificity
Specificity of human WDR62 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR62
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR62 Antibody

  • C19orf14MGC166976
  • chromosome 19 open reading frame 14
  • DKFZP434J046
  • DKFZp686G1024
  • EC 2.7.11.1
  • EC 2.7.7.38
  • FLJ33298
  • WD repeat domain 62
  • WD repeat-containing protein 62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
H00055835-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-67764
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-59027
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58439
Species: Hu
Applications: WB, ICC/IF
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
NBP1-89223
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA

Publications for WDR62 Antibody (NBP2-48788) (0)

There are no publications for WDR62 Antibody (NBP2-48788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR62 Antibody (NBP2-48788) (0)

There are no reviews for WDR62 Antibody (NBP2-48788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDR62 Antibody (NBP2-48788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR62 Products

Array NBP2-48788

Bioinformatics Tool for WDR62 Antibody (NBP2-48788)

Discover related pathways, diseases and genes to WDR62 Antibody (NBP2-48788). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR62 Antibody (NBP2-48788)

Discover more about diseases related to WDR62 Antibody (NBP2-48788).
 

Pathways for WDR62 Antibody (NBP2-48788)

View related products by pathway.

PTMs for WDR62 Antibody (NBP2-48788)

Learn more about PTMs related to WDR62 Antibody (NBP2-48788).

Blogs on WDR62

There are no specific blogs for WDR62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR62 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR62