WDR46 Antibody

Images

 
Immunohistochemistry-Paraffin: WDR46 Antibody [NBP1-94128] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR46 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDWVTKKLMCEINVMEAVRDIRFLHSEALLAVAQNRWLHIYDNQGIELHCIRRCDRVTRLEFLPFHFLLATASETGFLTYLDVSVGKIVAALNARAGRLDVMSQNPYNAVIHL
Specificity
Specificity of human WDR46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR46
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR46 Antibody

  • BING4FP221
  • C6orf11
  • chromosome 6 open reading frame 11
  • WD repeat domain 46
  • WD repeat-containing protein 46
  • WD repeat-containing protein BING4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89688
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59071
Species: Hu, Po, Bv, Sh
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92603
Species: Hu
Applications: WB, ICC/IF
NB100-56136
Species: Hu, Mu, Rt
Applications: WB, IB, IHC, IHC-P, IP
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-40844
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-56832
Species: Hu, Mu, Rt, Bv, Ca, GP
Applications: WB
H00023179-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00006018-M05
Species: Hu
Applications: WB, ELISA
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-82613
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45572
Species: Hu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-94128
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for WDR46 Antibody (NBP1-94128) (0)

There are no publications for WDR46 Antibody (NBP1-94128).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR46 Antibody (NBP1-94128) (0)

There are no reviews for WDR46 Antibody (NBP1-94128). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WDR46 Antibody (NBP1-94128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR46 Products

Bioinformatics Tool for WDR46 Antibody (NBP1-94128)

Discover related pathways, diseases and genes to WDR46 Antibody (NBP1-94128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR46 Antibody (NBP1-94128)

Discover more about diseases related to WDR46 Antibody (NBP1-94128).
 

Pathways for WDR46 Antibody (NBP1-94128)

View related products by pathway.

Blogs on WDR46

There are no specific blogs for WDR46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR46 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR46