We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

WDR26 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related WDR26 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-83628PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

WDR26 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR26.

Source: E. coli

Amino Acid Sequence: NDLNELKPLVHSPHAIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WDR26
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83628.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WDR26 Recombinant Protein Antigen

  • MIP2
  • myocardial ischemic preconditioning up-regulated protein 2
  • WD repeat domain 26
  • WD repeat-containing protein 26

Background

WDR26 (WD repeat-containing protein 26) contains five WD repeats and is a member of the WD family of proteins. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD proteins are involved in a variety of cellular processes. WDR26 may be involved in the negative regulation of MAPK signaling. Recently, it has been shown to be up-regulated by oxidative stress and play a role in H2O2-induced cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, MiAr, WB
DCP00
Species: Hu
Applications: ELISA
DY453
Species: Mu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
MM200
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NB110-40424
Species: Hu
Applications: IHC,  IHC-P, IP, WB
DRN00B
Species: Hu
Applications: ELISA
NBP3-16729
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, Simple Western, WB
201-LB
Species: Hu
Applications: BA
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83628PEP
Species: Hu
Applications: AC

Publications for WDR26 Protein (NBP1-83628PEP) (0)

There are no publications for WDR26 Protein (NBP1-83628PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR26 Protein (NBP1-83628PEP) (0)

There are no reviews for WDR26 Protein (NBP1-83628PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WDR26 Protein (NBP1-83628PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR26 Products

Array NBP1-83628PEP

Research Areas for WDR26 Protein (NBP1-83628PEP)

Find related products by research area.

Blogs on WDR26

There are no specific blogs for WDR26, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WDR26 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR26