We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

WDR26 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: WDR26 Antibody [NBP1-83628] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Staining of human cerebral cortex shows moderate positivity in neuropil.
Analysis in human cell line SK-MEL-30.
Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells) in seminiferous ducts.

Product Details

Summary
Product Discontinued
View other related WDR26 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83628
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

WDR26 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NDLNELKPLVHSPHAIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWE
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR26
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP1-83628 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for WDR26 Antibody - BSA Free

  • MIP2
  • myocardial ischemic preconditioning up-regulated protein 2
  • WD repeat domain 26
  • WD repeat-containing protein 26

Background

WDR26 (WD repeat-containing protein 26) contains five WD repeats and is a member of the WD family of proteins. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD proteins are involved in a variety of cellular processes. WDR26 may be involved in the negative regulation of MAPK signaling. Recently, it has been shown to be up-regulated by oxidative stress and play a role in H2O2-induced cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, MiAr, WB
DCP00
Species: Hu
Applications: ELISA
DY453
Species: Mu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
MM200
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NB110-40424
Species: Hu
Applications: IHC,  IHC-P, IP, WB
DRN00B
Species: Hu
Applications: ELISA
NBP3-16729
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, Simple Western, WB
201-LB
Species: Hu
Applications: BA
NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83628
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for WDR26 Antibody (NBP1-83628)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-83628 Applications Species
Patel L, Stratton S, McLaughlin M et al. Genome-wide CRISPR-Cas9 screen analyzed by SLIDER identifies network of repressor complexes that regulate TRIM24 iScience 2023-07-01 [PMID: 37426340] (WB, Human) WB Human
Patel L, Stratton S, McLaughlin M et al. Genomewide CRISPR/Cas9 Screen Identifies Network of Repressor Complexes That Regulate TRIM24 SSRN Electronic Journal 2022-08-25

Reviews for WDR26 Antibody (NBP1-83628) (0)

There are no reviews for WDR26 Antibody (NBP1-83628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WDR26 Antibody (NBP1-83628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR26 Products

Array NBP1-83628

Research Areas for WDR26 Antibody (NBP1-83628)

Find related products by research area.

Blogs on WDR26

There are no specific blogs for WDR26, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR26 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR26