WDR26 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WDR26 Antibody [NBP1-83628] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Staining of human cerebral cortex shows moderate positivity in neuropil.

Analysis in human cell line SK-MEL-30.

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells) in seminiferous ducts.

Product Discontinued

WDR26 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NDLNELKPLVHSPHAIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWE
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WDR26 Antibody - BSA Free

• MIP2
• myocardial ischemic preconditioning up-regulated protein 2
• WD repeat domain 26
• WD repeat-containing protein 26

Background

WDR26 (WD repeat-containing protein 26) contains five WD repeats and is a member of the WD family of proteins. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD proteins are involved in a variety of cellular processes. WDR26 may be involved in the negative regulation of MAPK signaling. Recently, it has been shown to be up-regulated by oxidative stress and play a role in H2O2-induced cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR26 Antibody (NBP1-83628)(2)

Publications using NBP1-83628

• Patel L, Stratton S, McLaughlin M et al. Genome-wide CRISPR-Cas9 screen analyzed by SLIDER identifies network of repressor complexes that regulate TRIM24 iScience 2023-07-01 [PMID: 37426340] (WB, Human)
• Patel L, Stratton S, McLaughlin M et al. Genomewide CRISPR/Cas9 Screen Identifies Network of Repressor Complexes That Regulate TRIM24 SSRN Electronic Journal 2022-08-25

Bioinformatics

• Gene Symbol: WDR26