WDFY2 Antibody - BSA Free

Western Blot: WDFY2 Antibody [NBP2-84331] - Host: Rabbit. Target Name: WDFY2. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WDFY2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human WDFY2. Peptide sequence: RQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDFY2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WDFY2 Antibody - BSA Free

• propeller-FYVE protein
• RP11-147H23.1
• WD repeat and FYVE domain containing 2
• WD repeat and FYVE domain-containing protein 2
• WD40 and FYVE domain containing 2
• WD40- and FYVE domain-containing protein 2
• WDF2
• ZFYVE22PROF
• Zinc finger FYVE domain-containing protein 22

Background

WDFY2 encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDFY2