WBP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: WBP4 Antibody [NBP2-55302] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WBP4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQ
Specificity
Specificity of human WBP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WBP4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for WBP4 Antibody

  • domain-containing binding protein 4
  • WW domain binding protein 4 (formin binding protein 21)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24724
Species: Hu, Mu, Rt, Ca, Eq, Pm, RM
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15972
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-92692
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88461
Species: Hu
Applications: IHC, IHC-P
NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-48542
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB, IP, KD
NBP2-24615
Species: Hu
Applications: WB, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24536
Species: Hu, Mu, RM
Applications: WB
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55302
Species: Hu
Applications: ICC/IF

Publications for WBP4 Antibody (NBP2-55302) (0)

There are no publications for WBP4 Antibody (NBP2-55302).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WBP4 Antibody (NBP2-55302) (0)

There are no reviews for WBP4 Antibody (NBP2-55302). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for WBP4 Antibody (NBP2-55302) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WBP4 Products

Bioinformatics Tool for WBP4 Antibody (NBP2-55302)

Discover related pathways, diseases and genes to WBP4 Antibody (NBP2-55302). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WBP4 Antibody (NBP2-55302)

Discover more about diseases related to WBP4 Antibody (NBP2-55302).
 

Pathways for WBP4 Antibody (NBP2-55302)

View related products by pathway.

Blogs on WBP4

There are no specific blogs for WBP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WBP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WBP4