WASF1/WAVE1 Antibody - BSA Free

Immunohistochemistry-Paraffin: WASF1/WAVE1 Antibody [NBP2-88584] - Rabbit Anti-WASF1 antibody. Catalog Number: ARP63994. Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification:

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WASF1/WAVE1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WASF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WASF1/WAVE1 Antibody - BSA Free

• KIAA0269WAVEhomology of dictyostelium scar 1
• Protein WAVE-1
• SCAR1
• SCAR1WASP family protein member 1
• Verprolin homology domain-containing protein 1
• WAS protein family, member 1
• WASF1
• WASP1
• WAVE1
• WAVE1FLJ31482
• wisk

Background

WASP (for Wiskott-Aldrich syndrome protein), N-WASP are downstream effectors of Cdc42 that are implicated in actin polymerization and cytoskeletal organization. The WASP family also includes VASP (vasodilator-stimulated phosphoprotein) and Mena (for mammalian enabled protein), which accumulate at focal adhesions and are also involved in the regulation of the actin cytoskeleton. The WAVE proteins are related to the WASP family proteins and are likewise involved in mediating actin reorganization downstream of the Rho family of small GTPases. The two protein homologs WAVE1 and WAVE2 specifically regulate membrane ruffling by inducing the formation of actin filament clusters in response to GTP binding and activating Rac. The WAVE proteins mediate this actin polymerization by cooperating with the Arp2/3 complex, a nucleation core, and thereby promoting the formation of actin filaments. WAVE1, which is also designated SCAR (for suppressor of cAR), is expressed primarily in the brain, while WAVE2 is widely expressed with the expression highest in peripheral blood leukocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WASF1