WARP/VWA1 Antibody - BSA Free

Western Blot: WARP/VWA1 Antibody [NBP3-10148] - Western blot analysis of WARP/VWA1 in Rat Brain lysates. Antibody dilution at 1ug/ml

Product Discontinued

WARP/VWA1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of rat WARP/VWA1 (NP_001013960 ). Peptide sequence LALAQSGIERGPTASAPQGDLLFLLDSSASVSHYEFSRVREFVGQLVATMP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VWA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WARP/VWA1 Antibody - BSA Free

• DKFZp761O051
• von Willebrand factor A domain containing 1
• von Willebrand factor A domain-containing protein 1
• von Willebrand factor A domain-related protein
• VWA1
• WARP

Background

VWA1 belongs to the von Willebrand factor (VWF; MIM 193400) A (VA) domain superfamily of extracellular matrix proteinsand appears to play a role in cartilage structure and function (Fitzgerald et al., 2002 (PubMed 12062410)).(suppliedby OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VWA1