VSIG2 Antibody - BSA Free

Western Blot: VSIG2 Antibody [NBP3-10182] - Western blot analysis of VSIG2 in Mouse Testis lysates. Antibody dilution at 1ug/ml

Product Discontinued

VSIG2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VSIG2 Antibody - BSA Free (NBP3-10182) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse VSIG2 (NP_065264.2). Peptide sequence DLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VSIG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VSIG2 Antibody - BSA Free

• 2210413P10Rik
• Cortical thymocyte-like protein
• CTH
• CTHCTXLcortical thymocyte receptor (X. laevis CTX) like
• CT-like protein
• CTXL
• V-set and immunoglobulin domain containing 2
• V-set and immunoglobulin domain-containing protein 2
• VSIG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VSIG2