VSIG2 Antibody

Images

 
Western Blot: VSIG2 Antibody [NBP1-84338] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: VSIG2 Antibody [NBP1-84338] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VSIG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VSIG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VSIG2 Protein (NBP1-84338PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VSIG2 Antibody

  • 2210413P10Rik
  • Cortical thymocyte-like protein
  • CTH
  • CTHCTXLcortical thymocyte receptor (X. laevis CTX) like
  • CT-like protein
  • CTXL
  • V-set and immunoglobulin domain containing 2
  • V-set and immunoglobulin domain-containing protein 2
  • VSIG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP1-59448
Species: Hu
Applications: WB
NBP1-57749
Species: Hu
Applications: WB, IHC
AF6146
Species: Hu
Applications: ICC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-74570
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for VSIG2 Antibody (NBP1-84338) (0)

There are no publications for VSIG2 Antibody (NBP1-84338).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSIG2 Antibody (NBP1-84338) (0)

There are no reviews for VSIG2 Antibody (NBP1-84338). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VSIG2 Antibody (NBP1-84338) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VSIG2 Products

Bioinformatics Tool for VSIG2 Antibody (NBP1-84338)

Discover related pathways, diseases and genes to VSIG2 Antibody (NBP1-84338). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VSIG2 Antibody (NBP1-84338)

Discover more about diseases related to VSIG2 Antibody (NBP1-84338).
 

Pathways for VSIG2 Antibody (NBP1-84338)

View related products by pathway.

Blogs on VSIG2

There are no specific blogs for VSIG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VSIG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VSIG2
Entrez