VPS41 Antibody

Images

 
Western Blot: VPS41 Antibody [NBP1-81640] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: VPS41 Antibody [NBP1-81640] - Staining of human duodenum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEM
Specificity
Specificity of human VPS41 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS41
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VPS41 Protein (NBP1-81640PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS41 Antibody

  • HVPS41
  • hVps41p
  • HVSP41
  • S53
  • vacuolar assembly protein 41
  • vacuolar protein sorting 41 (yeast homolog)
  • vacuolar protein sorting 41 (yeast)
  • vacuolar protein sorting 41 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 41 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00004675-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-65376
Species: Hu
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82906
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NB100-2440
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006275-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89728
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81640
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for VPS41 Antibody (NBP1-81640) (0)

There are no publications for VPS41 Antibody (NBP1-81640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS41 Antibody (NBP1-81640) (0)

There are no reviews for VPS41 Antibody (NBP1-81640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS41 Antibody (NBP1-81640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for VPS41 Antibody (NBP1-81640)

Discover related pathways, diseases and genes to VPS41 Antibody (NBP1-81640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS41 Antibody (NBP1-81640)

Discover more about diseases related to VPS41 Antibody (NBP1-81640).
 

Pathways for VPS41 Antibody (NBP1-81640)

View related products by pathway.

PTMs for VPS41 Antibody (NBP1-81640)

Learn more about PTMs related to VPS41 Antibody (NBP1-81640).
 

Research Areas for VPS41 Antibody (NBP1-81640)

Find related products by research area.

Blogs on VPS41.

VPS41 - An important regulator of lysosomal trafficking
Membrane fusion is an essential step during the trafficking of endosomes and vesicles throughout the cell. Membrane fusion events are facilitated by multisubunit tethering complexes (MTC) including CORVET and HOPS. These complexes interact with Rab...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS41