VPREB1 Antibody

Images

 
Western Blot: VPREB1 Antibody [NBP1-70741] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPREB1 Antibody Summary

Immunogen
Synthetic peptides corresponding to VPREB1(pre-B lymphocyte gene 1) The peptide sequence was selected from the middle region of VPREB1. Peptide sequence TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPREB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against VPREB1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VPREB1 Antibody

  • CD179 antigen-like family member A
  • CD179a
  • IGI
  • immunoglobulin iota chain
  • pre-B lymphocyte 1

Background

VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells. This gene encodes the iota polypeptide chain that is associated with the Ig-mu chain to form a molecular complex which is expressed on the surface of pre-B cells. The complex is thought to regulate Ig gene rearrangements in the early steps of B-cell differentiation.CD179a (VpreB) is a 126 aa-long polypeptide with apparent MW of 16-18 kDa. It is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells. CD179a has an Ig V domain-like structure, but lacks the last beta-strand (beta7) of a typical V domain. Instead, it has a carboxyl terminal end that shows no sequence homologies to any other proteins. CD179a associates non-covalently with CD179b (lambda5 or lambda-like) carrying an Ig C domain-like structure to form an Ig light chain-like structure, which is called the surrogate light chain or pseudo light chain. In this complex, the incomplete V domain of CD179a appears to be complemented by the extra beta7 strand of CD179b. On the surface of early preB cells, CD179a/CD179b surrogate light chain is disulfide-linked to membrane-bound Ig mu heavy chain in association with a signal transducer CD79a/CD79b heterodimer to form a B cell receptor-like structure, so-called preB cell receptor (preBCR). Though no CD179a-related human disease or pathology has been reported yet, the deficiency of other components of preB cell receptor such as CD179b, Ig mu heavy chain and CD79a has been shown to result in severe impairment of B cell development and agammaglobulinemia in human. PreBCR transduces signals for: 1) cellular proliferation, differentiation from the proB cell to preB cell stage, 2) allelic exclusion at the Ig heavy chain gene locus, and 3) promotion of Ig light chain gene rearrangements. Thus, preBCR functions as a checkpoint in early B cell development to monitor the production of Ig mu heavy chain through a functional rearrangement of Ig heavy chain gene as well as the potency of Ig mu heavy chain to associate with Ig light chain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
MAB7650
Species: Mu
Applications: WB, IHC
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP1-74190
Species: Mu
Applications: WB, ChIP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5165
Species: Hu, Mu
Applications: WB
AF6116
Species: Hu
Applications: WB, ICC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
366-6C/CF
Species: Hu
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for VPREB1 Antibody (NBP1-70741) (0)

There are no publications for VPREB1 Antibody (NBP1-70741).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPREB1 Antibody (NBP1-70741) (0)

There are no reviews for VPREB1 Antibody (NBP1-70741). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPREB1 Antibody (NBP1-70741) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPREB1 Products

VPREB1 NBP1-70741

Bioinformatics Tool for VPREB1 Antibody (NBP1-70741)

Discover related pathways, diseases and genes to VPREB1 Antibody (NBP1-70741). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPREB1 Antibody (NBP1-70741)

Discover more about diseases related to VPREB1 Antibody (NBP1-70741).
 

Pathways for VPREB1 Antibody (NBP1-70741)

View related products by pathway.

PTMs for VPREB1 Antibody (NBP1-70741)

Learn more about PTMs related to VPREB1 Antibody (NBP1-70741).

Blogs on VPREB1

There are no specific blogs for VPREB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPREB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPREB1