VMAT2 Antibody - BSA Free

Immunohistochemistry: VMAT2 Antibody [NBP2-68952] - Immunohistochemical staining of human caudate shows strong positivity in neuronal projections.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VMAT2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC18A2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  VMAT2 Recombinant Protein Antigen (NBP2-68952PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for VMAT2 Antibody - BSA Free

• MGC120477
• MNAT
• monoamine neurotransmitter transporter
• Monoamine transporter
• SLC18A2
• solute carrier family 18 (vesicular monoamine), member 2
• Solute carrier family 18 member 2
• SVAT
• SVMT
• SVMTMGC120478
• synaptic vesicular amine transporter
• VAT2
• VAT2MGC26538
• vesicle monoamine transporter type 2
• vesicle monoamine/H+ antiporter
• Vesicular amine transporter 2
• VMAT2

Background

VMAT2 (Vesicular amine transporter 2) acts to accumulate cytosolic monoamines into synaptic vesicles. Its function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders such as dementia with Lewy bodies. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC18A2