VMAT1/SLC18A1 Antibody

Images

 
Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-55798] - Staining of human adrenal gland shows moderate cytoplasmic positivity in medullary cells.
Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-55798] - Staining of human small intestine shows strong cytoplasmic positivity in neuroendocrine cells.
Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-55798] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-55798] - Staining of human rectum shows strong cytoplasmic positivity in neuroendocrine cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: VMAT1/SLC18A1 Antibody [NBP2-55798] - Analysis in human adrenal gland and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

VMAT1/SLC18A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
Specificity
Specificity of human VMAT1/SLC18A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC18A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-55798PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for VMAT1/SLC18A1 Antibody

  • CGAT
  • SLC18A1
  • solute carrier family 18 (vesicular monoamine), member 1
  • VAT1
  • VMAT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68123
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-91348
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002770-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-86922
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55798
Species: Hu
Applications: IHC, IHC-P

Publications for VMAT1/SLC18A1 Antibody (NBP2-55798) (0)

There are no publications for VMAT1/SLC18A1 Antibody (NBP2-55798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VMAT1/SLC18A1 Antibody (NBP2-55798) (0)

There are no reviews for VMAT1/SLC18A1 Antibody (NBP2-55798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VMAT1/SLC18A1 Antibody (NBP2-55798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VMAT1/SLC18A1 Products

Bioinformatics Tool for VMAT1/SLC18A1 Antibody (NBP2-55798)

Discover related pathways, diseases and genes to VMAT1/SLC18A1 Antibody (NBP2-55798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VMAT1/SLC18A1 Antibody (NBP2-55798)

Discover more about diseases related to VMAT1/SLC18A1 Antibody (NBP2-55798).
 

Pathways for VMAT1/SLC18A1 Antibody (NBP2-55798)

View related products by pathway.

PTMs for VMAT1/SLC18A1 Antibody (NBP2-55798)

Learn more about PTMs related to VMAT1/SLC18A1 Antibody (NBP2-55798).

Blogs on VMAT1/SLC18A1

There are no specific blogs for VMAT1/SLC18A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VMAT1/SLC18A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC18A1