| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit villin-like Antibody - BSA Free (NBP2-86054) is a polyclonal antibody validated for use in IHC and WB. Anti-villin-like Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of villin-like. Peptide sequence: NGPKTSISEKARGLALTYSLRDRERGGGRAQIGVVDDEAKAPDLMQIMEA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VILL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP2-86054 | Applications | Species |
|---|---|---|
| Zhu W, Qiong D, Yanli G et al. Proteomics and transcriptomics profiling reveals distinct aspects of kidney stone related genes in calculi rats BMC genomics 2023-03-17 [PMID: 36932340] (IHC, Rat) | IHC | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for villin-like Antibody (NBP2-86054)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | VILL |