Orthogonal Strategies: Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Analysis in human lung and liver tissues using NBP1-81501 antibody. Corresponding CACNA2D2 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human duodenum shows no cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human lung shows moderate cytoplasmic positivity in pneumocytes.
This antibody was developed against Recombinant Protein corresponding to amino acids: EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNA2D2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
The CACNA2D2 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-2 protein that exists in 5 isoforms: isoform 1: 1,150 amino acids long, 129 kDA; isoform 2: 1,143 amino acids long, 129 kDA; isoform 3: 1,145 amino acids long, 129 kDA; isoform 4: 1,076 amino acids long, 122 kDA; and isoform 5: 1,152 amino acids long, 130 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, as well as T-type. Overexpression of this gene triggers apoptosis. The CACNA2D2 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, regulation of insulin secretion, and transmission across chemical synapses. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D2 gene is associated with ataxia, seizures, lung cancer, and neuronitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our CACNA2D2 Antibody - BSA Free and receive a gift card or discount.