CACNA2D2 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Analysis in human lung and liver tissues using NBP1-81501 antibody. Corresponding CACNA2D2 RNA-seq data are presented for the more
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human duodenum shows no cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human lung shows moderate cytoplasmic positivity in pneumocytes.

Product Details

Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P, KD
Validated by:

Orthogonal Strategies


Order Details

CACNA2D2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB, KD reported in scientific literature (PMID:28469787).
Control Peptide
CACNA2D2 Protein (NBP1-81501PEP)
Read Publication using
NBP1-81501 in the following applications:

  • KD
    1 publication
  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28469787).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CACNA2D2 Antibody

  • alpha 2 delta calcium channel subunit
  • CACNA2D2
  • calcium channel, voltage-dependent, alpha 2/delta subunit 2
  • gene 26
  • KIAA0558
  • KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2
  • LUAC11.1
  • voltage-dependent calcium channel subunit alpha-2/delta-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, IF, IHC, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB

Publications for CACNA2D2 Antibody (NBP1-81501)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: KD, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for CACNA2D2 Antibody (NBP1-81501) (0)

There are no reviews for CACNA2D2 Antibody (NBP1-81501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNA2D2 Antibody (NBP1-81501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CACNA2D2 Products

Bioinformatics Tool for CACNA2D2 Antibody (NBP1-81501)

Discover related pathways, diseases and genes to CACNA2D2 Antibody (NBP1-81501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA2D2 Antibody (NBP1-81501)

Discover more about diseases related to CACNA2D2 Antibody (NBP1-81501).

Pathways for CACNA2D2 Antibody (NBP1-81501)

View related products by pathway.

PTMs for CACNA2D2 Antibody (NBP1-81501)

Learn more about PTMs related to CACNA2D2 Antibody (NBP1-81501).

Blogs on CACNA2D2

There are no specific blogs for CACNA2D2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CACNA2D2 Antibody and receive a gift card or discount.


Gene Symbol CACNA2D2