CACNA2D2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Analysis in human lung and liver tissues using NBP1-81501 antibody. Corresponding CACNA2D2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human duodenum shows no cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CACNA2D2 Antibody [NBP1-81501] - Staining of human lung shows moderate cytoplasmic positivity in pneumocytes.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CACNA2D2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA2D2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB, KD reported in scientific literature (PMID:28469787).
• Control Peptide:

  CACNA2D2 Protein (NBP1-81501PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28469787).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CACNA2D2 Antibody - BSA Free

• alpha 2 delta calcium channel subunit
• CACNA2D
• CACNA2D2
• calcium channel, voltage-dependent, alpha 2/delta subunit 2
• gene 26
• KIAA0558
• KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2
• LUAC11.1
• voltage-dependent calcium channel subunit alpha-2/delta-2

Background

The CACNA2D2 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-2 protein that exists in 5 isoforms: isoform 1: 1,150 amino acids long, 129 kDA; isoform 2: 1,143 amino acids long, 129 kDA; isoform 3: 1,145 amino acids long, 129 kDA; isoform 4: 1,076 amino acids long, 122 kDA; and isoform 5: 1,152 amino acids long, 130 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, as well as T-type. Overexpression of this gene triggers apoptosis. The CACNA2D2 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, regulation of insulin secretion, and transmission across chemical synapses. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D2 gene is associated with ataxia, seizures, lung cancer, and neuronitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CACNA2D2 Antibody (NBP1-81501)(2)

Publications using NBP1-81501

• Van Wauwe J, Mahy A, Craps S et al. PRDM16 determines specification of ventricular cardiomyocytes by suppressing alternative cell fates Life Science Alliance 2024-09-20 [PMID: 39304345]
• Zhang J, Wu L, Li Z et al. miR-1231 exacerbates arrhythmia by targeting calciumchannel gene CACNA2D2 in myocardial infarction Am J Transl Res. 2017-04-14 [PMID: 28469787] (WB, KD, Rat, Human)

Bioinformatics

• Gene Symbol: CACNA2D2