villin-like Antibody

Images

 
Western Blot: villin-like Antibody [NBP2-86053] - WB Suggested Anti-VILL Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

villin-like Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of villin-like. Peptide sequence: EDLPEGVDPARREFYLSDSDFQDIFGKSKEEFYSMATWRQRQEKKQLGFF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
VILL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for villin-like Antibody

  • EC 2.2.1.2
  • EC 6.3.2.6
  • VILL
  • villin like
  • Villin-Like Protein
  • Villin-Like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-59398
Species: Hu
Applications: WB
NBP1-53169
Species: Hu
Applications: IHC, IHC-P, WB
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
NBP3-06065
Species: Hu
Applications: IHC, IHC-P
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-87947
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81501
Species: Hu, Rt
Applications: IHC, IHC-P, KD, WB
207-IL/CF
Species: Hu
Applications: BA
NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF2849
Species: Mu, Rt
Applications: WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-34118
Species: Hu
Applications: IHC, IHC-P, WB
AF756
Species: Mu
Applications: IHC, WB

Publications for villin-like Antibody (NBP2-86053) (0)

There are no publications for villin-like Antibody (NBP2-86053).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for villin-like Antibody (NBP2-86053) (0)

There are no reviews for villin-like Antibody (NBP2-86053). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for villin-like Antibody (NBP2-86053) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional villin-like Products

Bioinformatics Tool for villin-like Antibody (NBP2-86053)

Discover related pathways, diseases and genes to villin-like Antibody (NBP2-86053). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for villin-like Antibody (NBP2-86053)

Discover more about diseases related to villin-like Antibody (NBP2-86053).
 

Pathways for villin-like Antibody (NBP2-86053)

View related products by pathway.

PTMs for villin-like Antibody (NBP2-86053)

Learn more about PTMs related to villin-like Antibody (NBP2-86053).
 

Research Areas for villin-like Antibody (NBP2-86053)

Find related products by research area.

Blogs on villin-like

There are no specific blogs for villin-like, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our villin-like Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VILL