VGLUT2 Recombinant Protein Antigen

Images

 
There are currently no images for VGLUT2 Recombinant Protein Antigen (NBP2-46641PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VGLUT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VGLUT2.

Source: E. coli

Amino Acid Sequence: CGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC17A6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46641.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VGLUT2 Recombinant Protein Antigen

  • differentiation-associated BNPI
  • differentiation-associated Na(+)-dependent inorganic phosphate cotransporter
  • differentiation-associated Na-dependent inorganic phosphate cotransporter
  • DNPI
  • solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6
  • solute carrier family 17 member 6
  • vesicular glutamate transporter 2
  • VGLUT2

Background

VGLUT2 is a sodium dependent inorganic phosphate cotransporter that is involved in the calcium dependent glutamate release from astrocytes. It is expressed in only a subset of neurons, localized to synaptic vesicles, at synapses exhibiting classical excitatory features. VGLUT2 mRNA is found in brain regions that lack VGLUT1, a related protein also displaying sodium dependent inorganic phosphate cotransporter activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-20857
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-25973
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF2247
Species: Hu
Applications: IHC, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB
NB100-91348
Species: Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
NB120-11427
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF5065
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC,  IHC-P, IP, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB

Publications for VGLUT2 Recombinant Protein Antigen (NBP2-46641PEP) (0)

There are no publications for VGLUT2 Recombinant Protein Antigen (NBP2-46641PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VGLUT2 Recombinant Protein Antigen (NBP2-46641PEP) (0)

There are no reviews for VGLUT2 Recombinant Protein Antigen (NBP2-46641PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VGLUT2 Recombinant Protein Antigen (NBP2-46641PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VGLUT2 Products

Array NBP2-46641PEP

Research Areas for VGLUT2 Recombinant Protein Antigen (NBP2-46641PEP)

Find related products by research area.

Blogs on VGLUT2

There are no specific blogs for VGLUT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VGLUT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC17A6