VGLL3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VGLL3 Antibody [NBP2-31590] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.

• Reactivity: Hu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VGLL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VGLL3 Antibody - BSA Free (NBP2-31590) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-VGLL3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQE
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VGLL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  VGLL3 Protein (NBP2-31590PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for VGLL3 Antibody - BSA Free

• colon carcinoma related protein
• DKFZp686O1845
• FLJ38507
• transcription cofactor vestigial-like protein 3
• vestigial like 3 (Drosophila)
• vestigial-like 3
• VGL3
• VGL-3

Background

VGLL3 may act as a specific coactivator for the mammalian TEFs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VGLL3 Antibody (NBP2-31590)(2)

Publications using NBP2-31590

• Haque R, Lee J, Chung J et al. VGLL3 expression is associated with macrophage infiltration and predicts poor prognosis in epithelial ovarian cancer Research Square 2022-12-06 (WB, Human)
• Haque R, Lee J, Chung JY et al. VGLL3 expression is associated with macrophage infiltration and predicts poor prognosis in epithelial ovarian cancer Frontiers in oncology 2023-06-05 [PMID: 37342190] (Immunohistochemistry, Human)

Bioinformatics

• Gene Symbol: VGLL3
• Uniprot:
  • A8MV65(Human)