We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

VGF Recombinant Protein Antigen

Images

 
There are currently no images for VGF Recombinant Protein Antigen (NBP2-31596PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VGF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VGF.

Source: E. coli

Amino Acid Sequence: APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VGF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31596.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VGF Recombinant Protein Antigen

  • neuro-endocrine specific protein VGF
  • neurosecretory protein VGF
  • VGF nerve growth factor inducible
  • VGF

Background

Nerve growth factor (NGF) is a peptide that plays a key role in the differentiation and survival of neurons in the peripheral nervous system (PNS) and the central nervous system (CNS). VGF is a peptide synthesized and secreted by neurons and is upregulated by NGF in the PC12 cell line. VGF is widely expressed in both the PNS and CNS, but is especially abundant in the adult hypothalamus. VGF plays an essential role in how the brain regulates energy expenditure and body weight. Its expression is rapidly induced by injury, the circadian clock, and neuronal activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DBD00
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
256-GF
Species: Hu
Applications: BA
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
NBP1-80797
Species: Hu
Applications: IHC,  IHC-P
DVE00
Species: Hu
Applications: ELISA
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF2818
Species: Hu
Applications: ICC, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-80782
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF482
Species: Mu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-31596PEP
Species: Hu
Applications: AC

Publications for VGF Recombinant Protein Antigen (NBP2-31596PEP) (0)

There are no publications for VGF Recombinant Protein Antigen (NBP2-31596PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VGF Recombinant Protein Antigen (NBP2-31596PEP) (0)

There are no reviews for VGF Recombinant Protein Antigen (NBP2-31596PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VGF Recombinant Protein Antigen (NBP2-31596PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VGF Products

Research Areas for VGF Recombinant Protein Antigen (NBP2-31596PEP)

Find related products by research area.

Blogs on VGF

There are no specific blogs for VGF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VGF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VGF