VGCNL1 Antibody

Images

 
Immunohistochemistry-Paraffin: VGCNL1 Antibody [NBP1-90026] - Staining of human hippocampus shows moderate granular positivity in neuronal cells and neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VGCNL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIVGREHRFRNFCRVVVRARFNASKTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NALCN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
VGCNL1 Protein (NBP1-90026PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VGCNL1 Antibody

  • bA430M15.1
  • CanIonFLJ44659
  • FLJ23913
  • FLJ44764
  • four repeat voltage-gated ion channel
  • MGC74524
  • sodium leak channel non-selective protein
  • sodium leak channel, non-selective
  • VGCNL1
  • voltage gated channel like 1
  • Voltage gated channel-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00058508-R04
Species: Hu
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP2-43567
Species: Hu, Mu
Applications: WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90026
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for VGCNL1 Antibody (NBP1-90026) (0)

There are no publications for VGCNL1 Antibody (NBP1-90026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VGCNL1 Antibody (NBP1-90026) (0)

There are no reviews for VGCNL1 Antibody (NBP1-90026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VGCNL1 Antibody (NBP1-90026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VGCNL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NALCN