UNC79 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UNC79 Antibody [NBP2-68927] - Staining of human cell line SH-SY5Y shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UNC79 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UNC79
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
UNC79 Recombinant Protein Antigen (NBP2-68927PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for UNC79 Antibody

  • KIAA1409
  • Protein Unc-79 Homolog
  • Unc-79 Homolog (C. Elegans)
  • Unc-79 Homolog
  • Unc-79 Homolog, NALCN Channel Complex Subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22410
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-33409
Species: Hu
Applications: ICC/IF, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-509
Species: Hu, Mu
Applications: IP, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB300-242
Species: Hu
Applications: WB

Publications for UNC79 Antibody (NBP2-68927) (0)

There are no publications for UNC79 Antibody (NBP2-68927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC79 Antibody (NBP2-68927) (0)

There are no reviews for UNC79 Antibody (NBP2-68927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UNC79 Antibody (NBP2-68927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UNC79 Products

Array NBP2-68927

Bioinformatics Tool for UNC79 Antibody (NBP2-68927)

Discover related pathways, diseases and genes to UNC79 Antibody (NBP2-68927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UNC79

There are no specific blogs for UNC79, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UNC79 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UNC79