VENTX Antibody

Images

 
Immunohistochemistry-Paraffin: VENTX Antibody [NBP2-30751] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VENTX Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VENTX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VENTX Protein (NBP2-30751PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VENTX Antibody

  • homeobox protein VENTX
  • HPX42BNA88A
  • MGC119910
  • MGC119911
  • VENT homeobox homolog (Xenopus laevis)
  • VENT homeobox homolog
  • VENT-like homeobox 2
  • VENT-like homeobox protein 2
  • VENTX2hemopoietic progenitor homeobox protein VENTX2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2250
Species: Hu
Applications: WB, IHC
AF6567
Species: Hu, Mu
Applications: WB, IHC

Publications for VENTX Antibody (NBP2-30751) (0)

There are no publications for VENTX Antibody (NBP2-30751).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VENTX Antibody (NBP2-30751) (0)

There are no reviews for VENTX Antibody (NBP2-30751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VENTX Antibody (NBP2-30751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VENTX Products

Bioinformatics Tool for VENTX Antibody (NBP2-30751)

Discover related pathways, diseases and genes to VENTX Antibody (NBP2-30751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VENTX Antibody (NBP2-30751)

Discover more about diseases related to VENTX Antibody (NBP2-30751).
 

Pathways for VENTX Antibody (NBP2-30751)

View related products by pathway.

Blogs on VENTX

There are no specific blogs for VENTX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VENTX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VENTX
Uniprot