VEGFR3/Flt-4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

VEGFR3/Flt-4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VEGF R3/Flt-4.
  
  

  Source: E.coli

  Amino Acid Sequence: LEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLH

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FLT4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP2-68669. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for VEGFR3/Flt-4 Recombinant Protein Antigen

• EC 2.7.10
• EC 2.7.10.1
• FLT4
• Flt-4
• fms-related tyrosine kinase 4
• LMPH1A
• PCLFLT41
• soluble VEGFR3 variant 1
• soluble VEGFR3 variant 2
• soluble VEGFR3 variant 3
• Tyrosine-protein kinase receptor FLT4
• vascular endothelial growth factor receptor 3
• VEGF R3
• VEGFR3
• VEGFR-3
• VEGFR3Fms-like tyrosine kinase 4

Background

FLT4, a VEGF Receptor type protein kinase, is an endothelial cell-specific receptor. Binding of the extracellular domain of FLT4 to the vascular endothelial growth factor-related protein VEGF-C stimulates tyrosine phosphorylation and mitogenesis of endothelial cells. FLT4 (-/-) mice have been shown to have defective blood vessel development in early embryos and to experience cardiovascular failure at embryonic day 9.5. A mutation in the FLT4 gene has been implicated in human hereditary lymphedema type I. Similarly, a mutation in the conserved catalytic domain of FLT4, in close proximity to the FLT4 mutations in human primary lymphedema, has been linked to the Chy mouse mutant.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FLT4