VEGFR3/Flt-4 Recombinant Protein Antigen

Images

 
There are currently no images for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VEGFR3/Flt-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VEGF R3/Flt-4.

Source: E.coli

Amino Acid Sequence: LEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FLT4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68669. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for VEGFR3/Flt-4 Recombinant Protein Antigen

  • EC 2.7.10
  • EC 2.7.10.1
  • FLT4
  • Flt-4
  • fms-related tyrosine kinase 4
  • LMPH1A
  • PCLFLT41
  • soluble VEGFR3 variant 1
  • soluble VEGFR3 variant 2
  • soluble VEGFR3 variant 3
  • Tyrosine-protein kinase receptor FLT4
  • vascular endothelial growth factor receptor 3
  • VEGF R3
  • VEGFR3
  • VEGFR-3
  • VEGFR3Fms-like tyrosine kinase 4

Background

FLT4, a VEGF Receptor type protein kinase, is an endothelial cell-specific receptor. Binding of the extracellular domain of FLT4 to the vascular endothelial growth factor-related protein VEGF-C stimulates tyrosine phosphorylation and mitogenesis of endothelial cells. FLT4 (-/-) mice have been shown to have defective blood vessel development in early embryos and to experience cardiovascular failure at embryonic day 9.5. A mutation in the FLT4 gene has been implicated in human hereditary lymphedema type I. Similarly, a mutation in the conserved catalytic domain of FLT4, in close proximity to the FLT4 mutations in human primary lymphedema, has been linked to the Chy mouse mutant.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVEC00
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
AF644
Species: Mu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
DVED00
Species: Hu
Applications: ELISA
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP1-90267
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF2125
Species: Mu
Applications: IHC, WB
AF3244
Species: Mu
Applications: IHC, WB
AF3628
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
MAB7265
Species: Mu
Applications: IHC, WB
DPG00
Species: Hu
Applications: ELISA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-68669PEP
Species: Hu
Applications: AC

Publications for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP) (0)

There are no publications for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP) (0)

There are no reviews for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VEGFR3/Flt-4 Products

Bioinformatics Tool for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP)

Discover related pathways, diseases and genes to VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP)

Discover more about diseases related to VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP).
 

Pathways for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP)

View related products by pathway.

PTMs for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP)

Learn more about PTMs related to VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP).
 

Research Areas for VEGFR3/Flt-4 Recombinant Protein Antigen (NBP2-68669PEP)

Find related products by research area.

Blogs on VEGFR3/Flt-4

There are no specific blogs for VEGFR3/Flt-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VEGFR3/Flt-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT4