VEGF-D Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FIGF. Source: E. coli
Amino Acid Sequence: TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
VEGFD |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86865. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for VEGF-D Recombinant Protein Antigen
Background
Vascular Endothelial Growth Factor D (VEGFD), also known as c-fos-induced growth factor (FIGF), is a member of the VEGF family of growth factors. Vascular endothelial growth factors (VEGFs) are a family of closely related growth factors having a conserved pattern of eight cysteine residues and sharing common VEGF receptors. VEGFs stimulate endothelial cells, induce angiogenesis, promote cell migration, increase vascular permeability, and inhibit apoptosis. VEGFD is most closely related to VEGFC (23.3% amino acid sequence identity) and has a similar VEGF homology domain that spans the middle third of the precursor protein and the long N-terminal and C-terminal extensions. In adults, VEGFD is highly expressed in lung, heart, muscle, and small intestine. VEGFD expression in fibroblasts is induced by cell interaction mediated by cadherin 11. Recombinant human VEGFD is a ligand for the tyrosine kinases, VEGFR2 (Flk1) and VEGF receptor 3 (Flt4). Since VEGFR3 is strongly expressed in lymphatic endothelial cells, it is postulated that VEGFD is involved in the regulation of the growth and/or differentiation of lymphatic endothelium and thus, a mitogen for endothelial cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for VEGF-D Protein (NBP1-86865PEP) (0)
There are no publications for VEGF-D Protein (NBP1-86865PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VEGF-D Protein (NBP1-86865PEP) (0)
There are no reviews for VEGF-D Protein (NBP1-86865PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for VEGF-D Protein (NBP1-86865PEP) (0)
Additional VEGF-D Products
Research Areas for VEGF-D Protein (NBP1-86865PEP)
Find related products by research area.
|
Blogs on VEGF-D