VEGF-D Recombinant Protein Antigen

Images

 
There are currently no images for VEGF-D Protein (NBP1-86865PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VEGF-D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FIGF.

Source: E. coli

Amino Acid Sequence: TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VEGFD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86865.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VEGF-D Recombinant Protein Antigen

  • c-fos induced growth factor (vascular endothelial growth factor D)
  • FIGF
  • vascular endothelial growth factor D
  • VEGFD
  • VEGF-D
  • VEGF-DVEGFDc-Fos-induced growth factor

Background

Vascular Endothelial Growth Factor D (VEGFD), also known as c-fos-induced growth factor (FIGF), is a member of the VEGF family of growth factors. Vascular endothelial growth factors (VEGFs) are a family of closely related growth factors having a conserved pattern of eight cysteine residues and sharing common VEGF receptors. VEGFs stimulate endothelial cells, induce angiogenesis, promote cell migration, increase vascular permeability, and inhibit apoptosis. VEGFD is most closely related to VEGFC (23.3% amino acid sequence identity) and has a similar VEGF homology domain that spans the middle third of the precursor protein and the long N-terminal and C-terminal extensions. In adults, VEGFD is highly expressed in lung, heart, muscle, and small intestine. VEGFD expression in fibroblasts is induced by cell interaction mediated by cadherin 11. Recombinant human VEGFD is a ligand for the tyrosine kinases, VEGFR2 (Flk1) and VEGF receptor 3 (Flt4). Since VEGFR3 is strongly expressed in lymphatic endothelial cells, it is postulated that VEGFD is involved in the regulation of the growth and/or differentiation of lymphatic endothelium and thus, a mitogen for endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVEC00
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
AF743
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF644
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
AF2125
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
DPG00
Species: Hu
Applications: ELISA
AF751
Species: Hu
Applications: WB
AF3244
Species: Mu
Applications: IHC, Simple Western, WB
AF751
Species: Hu
Applications: WB
DANG20
Species: Hu
Applications: ELISA
233-FB
Species: Hu
Applications: BA
923-AN
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for VEGF-D Protein (NBP1-86865PEP) (0)

There are no publications for VEGF-D Protein (NBP1-86865PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGF-D Protein (NBP1-86865PEP) (0)

There are no reviews for VEGF-D Protein (NBP1-86865PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VEGF-D Protein (NBP1-86865PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VEGF-D Products

Research Areas for VEGF-D Protein (NBP1-86865PEP)

Find related products by research area.

Blogs on VEGF-D

There are no specific blogs for VEGF-D, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VEGF-D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VEGFD