Recombinant Human VEGF 165 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related VEGF 165 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-46265
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human VEGF 165 Protein Summary

Description
A biologically active protein corresponding to VEGFA. Accession #: P15692-4.

Source: HEK293

Amino Acid Sequence:APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Preparation
Method
A DNA sequence encoding the human splice isoform VEGF-165 protein sequence (containing the signal peptide sequence, and the mature human VEGF-165 sequence) was expressed in modified human 293 cells.
Details of Functionality
The ED50 of VEGF-165 HCX is typically 2.0-7.0 ng/ml as measured in a cell proliferation assay using human umbilical vein endothelial (HUVEC) cells.
Source
HEK293
Protein/Peptide Type
Biologically Active Protein
Gene
VEGFA
Purity
>95%, by SDS-PAGE with silver staining

Applications/Dilutions

Dilutions
  • Block/Neutralize
  • Functional
  • Western Blot
Application Notes
This protein is functionally active and is useful for Blocking and Neutralizing. It can also be used for Western Blot.
Theoretical MW
19.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C.
Buffer
When reconstituted, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Preservative
No Preservative
Concentration
LYOPH
Purity
>95%, by SDS-PAGE with silver staining
Reconstitution Instructions
Reconstitute with 0.5 ml sterilized PBS.

Notes

After reconstitution, short-term storage at 4C is recommended. Aliquot and store at -18C to -20 C; avoid repeated freeze-thaw cycles. Disclaimer Note -Disclaimer Note - Human Serum- No test method can provide total assurance that the hepatitis B virus, hepatitis C virus, human immunodeficiency virus, or any other infectious agents are absent. Thus, all blood products, including purified proteins derived from human blood sources, should be handled at Biosafety Level 2 as recommended by the CDC\NIH manual entitled Biosafety in Microbiological and Biomedical Laboratories for potentially infectious human serum, blood specimens or proteins derived from same. Source material for the human blood product supplied to your facility has been tested for the detection of HIV antibody, Hepatitis B surface antigen, antibody to Hepatitis C, HIV 1 antigen(s), antibody to HTLV - I/II, and syphilis by FDA guidelines. All units were found to be non-reactive/negative for these tests. All human blood source material is collected in FDA licensed centers and is tested with FDA approved test kits. Human Serum- No test method can provide total assurance that the hepatitis B virus, hepatitis C virus, human immunodeficiency virus, or any other infectious agents are absent. Thus, all blood products, including purified proteins derived from human blood sources, should be handled at Biosafety Level 2 as recommended by the CDC\NIH manual entitled Biosafety in Microbiological and Biomedical Laboratories for potentially infectious human serum, blood specimens or proteins derived from same. Source material for the human blood product supplied to your facility has been tested for the detection of HIV antibody, Hepatitis B surface antigen, antibody to Hepatitis C, HIV 1 antigen(s), antibody to HTLV - I/II, and syphilis by FDA guidelines. All units were found to be non-reactive/negative for these tests. All human blood source material is collected in FDA licensed centers and is tested with FDA approved test kits.

Alternate Names for Recombinant Human VEGF 165 Protein

  • MVCD1
  • vascular endothelial growth factor A
  • Vascular permeability factor
  • VEGF-A
  • VEGFMGC70609
  • VPFvascular endothelial growth factor

Background

Vascular endothelial growth factor (VEGF) is a member of the cysteine-knot growth factor superfamily. Five VEGF splice variants exist including VEGF-121, VEGF-145, VEGF-165, VEGF-189; and VEGF-206. VEGF-165 is the most abundant and active isoform. VEGF-165 functions as a growth factor in angiogenesis, vasculogenesis and endothelial cell growth. It is widely expressed by normal tissues and by many tumor cells in response to a variety of cytokines, oncogene expression and hypoxia. VEGF-165 acts as a specific mitogen and survival factor for vascular endothelial cells, inducing microvascular permeability, cell migration and regulates the differentiation and survival of hematopoietic progenitor cells to affect hematopoiesis, immune function and tumour progression. VEGF-165 also plays roles in neurogenesis and blood brain barrier function. Local administration of VEGF-165 has been shown to enhance re-endothelialization in denuded arteries in vivo and increase new blood vessel formation in ischemic myocardium and limbs. Inhibitors of VEGF also have potential therapeutic applications, particularly as angiogenesis inhibitors to inhibit the growth of solid tumours. Structurally, VEGF-165 is related to platelet-derived growth factor (PDGF) and exists as disulfide linked homodimer and contains 4 potential N-linked glycosylation sites. This is a HCX protein. HCX Expression System Details HCX proteins mimic the proteins in the human body because they are expressed from human, rather than animal, insect or bacterial cells. This process gives them human post-translational modifications. Recombinant DNA techniques allow a human protein with the correct amino acid sequence to be expressed in a non-human cell line. However, non-human cells lack the appropriate cellular machinery, such as specific glycosyltransferases, necessary to produce the correct human post-translational modifications of a protein. An extreme example is seen in E. coli cells, which produce recombinant proteins with no glycosylation, as the above figure illustrates. Rodent and yeast cells are able to glycosylate proteins, but they are still different from glycosylation in human cells. Expression System Resultant Proteins Human (e.g. K562, HEK293) Correct amino acid sequence Human post-translational modifications Rodent (e.g. CHO, NSO) Correct amino acid sequence Some natural glycosylation - not human-like Yeast (e.g. Pichia) Correct amino acid sequence Some natural glycosylation - not human-like E.Coli Correct amino acid sequence No PTMs Although there have been significant attempts to make non-human cell derived cytokines more human-like, there is a growing awareness that in many instances, particularly in therapeutics, cytokines should mimic those found in the body as closely as possible.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 2 years from date of receipt.

Customers Who Viewed This Item Also Viewed...

233-FB
Species: Hu
Applications: BA
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
AF644
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
M6000B
Species: Mu
Applications: ELISA
923-AN
Species: Hu
Applications: BA
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
AF4117
Species: Rt
Applications: IHC, WB
DPG00
Species: Hu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
294-HG
Species: Hu
Applications: BA

Publications for VEGF 165 Biologically Active Protein (NBP1-46265) (0)

There are no publications for VEGF 165 Biologically Active Protein (NBP1-46265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGF 165 Biologically Active Protein (NBP1-46265) (0)

There are no reviews for VEGF 165 Biologically Active Protein (NBP1-46265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VEGF 165 Biologically Active Protein (NBP1-46265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VEGF 165 Products

Research Areas for VEGF 165 Biologically Active Protein (NBP1-46265)

Find related products by research area.

Blogs on VEGF 165

There are no specific blogs for VEGF 165, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VEGF 165 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VEGFA