VDAC3 Antibody (1C6)

Images

 
Sandwich ELISA: VDAC3 Antibody (1C6) [H00007419-M03] - Detection limit for recombinant GST tagged VDAC3 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VDAC3 Antibody (1C6) Summary

Immunogen
VDAC3 (AAH56870, 1 a.a. ~ 283 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
Specificity
Reacts with voltage-dependent anion channel 3.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VDAC3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VDAC3 Antibody (1C6)

  • HD-VDAC3
  • hVDAC3
  • Outer mitochondrial membrane protein porin 3
  • VDAC-3
  • voltage-dependent anion channel 3
  • voltage-dependent anion-selective channel protein 3

Background

VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase (see HK1; MIM 142600) and glycerol kinase (GK; MIM 300474) (Rahmani et al., 1998).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
NBP2-20849
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-59379
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-85571
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67460
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-89172
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
233-FB/CF
Species: Hu
Applications: BA
NBP2-53295
Species: Hu
Applications: ELISA, IHC, IHC-P, PA, WB

Publications for VDAC3 Antibody (H00007419-M03) (0)

There are no publications for VDAC3 Antibody (H00007419-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC3 Antibody (H00007419-M03) (0)

There are no reviews for VDAC3 Antibody (H00007419-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VDAC3 Antibody (H00007419-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VDAC3 Products

Bioinformatics Tool for VDAC3 Antibody (H00007419-M03)

Discover related pathways, diseases and genes to VDAC3 Antibody (H00007419-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDAC3 Antibody (H00007419-M03)

Discover more about diseases related to VDAC3 Antibody (H00007419-M03).
 

Pathways for VDAC3 Antibody (H00007419-M03)

View related products by pathway.

PTMs for VDAC3 Antibody (H00007419-M03)

Learn more about PTMs related to VDAC3 Antibody (H00007419-M03).
 

Research Areas for VDAC3 Antibody (H00007419-M03)

Find related products by research area.

Blogs on VDAC3

There are no specific blogs for VDAC3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VDAC3 Antibody (1C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol VDAC3
Entrez
Uniprot