Home » VAX1 » VAX1 Antibodies » VAX1 Antibody (2F4)

VAX1 Antibody (2F4)

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in PC-12 (Cat # L012V1).
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in HepG2 (Cat # L019V1).
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: VAX1 Antibody (2F4) [H00011023-M03] - Detection limit for recombinant GST tagged VAX1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

VAX1 Antibody (2F4) Summary

Immunogen
VAX1 (NP_954582.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRP
Specificity
Reacts with ventral anterior homeobox 1.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VAX1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00011023-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VAX1 Antibody (2F4)

  • MGC126743
  • MGC126745
  • ventral anterior homeobox 1

Background

This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pax6 Antibody
NB300-750
Western Blot: Pax6 Antibody [NB300-750] - Analysis of sheep retinal extract
Immunocytochemistry/Immunofluorescence: Pax6 Antibody [NB300-750] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a PAX6 polyclonal antibody at a dilution of 1:400 for 30 minutes at room temperature. F-Actin (red) was stained with DyLight 554 Phalloidin were stained with Hoechst 33342 dye.
Western Blot: Pax6 Antibody [NB300-750] - Analysis of rat whole eye extract
(4 Reviews)
(5 Publications)
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
VAX2 Antibody
NBP2-15161
Immunocytochemistry/Immunofluorescence: VAX2 Antibody [NBP2-15161] - Paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Western Blot: VAX2 Antibody [NBP2-15161] - Sample (30 ug of whole cell lysate) A: Jurkat 12% SDS PAGE, antibody diluted at 1:500.
Species: Hu
Applications: ICC/IF, WB
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(56 Publications)
Species: Hu
Applications: BA
Otx2 Antibody
[Unconjugated]
AF1979
Otx2 was detected in immersion fixed NTera‑2 human testicular embryonic carcinoma cell line using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Otx2 was detected in immersion fixed paraffin-embedded sections of mouse embryo (14 d.p.c.) using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to developing nervous system. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Simple Western lane view shows lysates of IMR‑32 human neuroblastoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Otx2 at approximately 48 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(74 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
RAX Antibody
NB100-56467
Western Blot: RAX Antibody [NB100-56467] - analysis of Rax in the 1) absence and 2) presence of immunizing peptide in Jurkat cell lysate using this antibody. 5 ug/ml.
Species: Ca, Hu, Pm
Applications: WB
Pax2 Antibody
[Unconjugated]
AF3364
Pax2 was detected in immersion fixed BG01V human embryonic stem cells differentiated into the early otic lineage using Goat Anti-Human Pax2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3364) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Western blot shows lysates of COLO 205 human colorectal adenocarcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human Pax2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3364) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Pax2 at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(12 Publications)
Species: Hu
Applications: ICC, IHC, WB
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western lane view shows lysates of K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for PKR at approximately 73 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
PKR was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line stimulated with rhIFN-alpha (Catalog # 11110-1) using Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PKR at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
Netrin-1
[Unconjugated]
1109-N1/CF
1 μg/lane of Recombinant Mouse Netrin-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 83 kDa.
(33 Publications)
Species: Mu
Applications: Bind
COUP-TF I/NR2F1
Antibody
NBP1-31259
Western Blot: COUP-TF I/NR2F1 Antibody [NBP1-31259] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with COUP TF1 antibody [N1], N-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Frozen: COUP-TF I/NR2F1 Antibody [NBP1-31259] - Analysis of embryonic mouse brain tissue using COUP-TF I/NR2F1 antibody. Primary antibody dilution:1:200. Citrate retrieval done 30um thick sections. Image from verified customer review.
Immunohistochemistry-Paraffin: COUP-TF I/NR2F1 Antibody [NBP1-31259] - Mouse hind brain. COUP TF1 antibody [N1], N-term diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Smoothened Antibody
NBP3-06699
Western Blot: Smoothened Antibody [NBP3-06699] - Western blot analysis of lysates from HUVEC cells, using Smoothened Antibody. The lane on the right is blocked with the synthesized peptide.
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP3-06699] - Human Small Intestine, Plasma: Formalin-Fixed, Paraffin-Embedded (FFPE)
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP3-06699] - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Emx1 Antibody
NBP1-86500
Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human kidney shows moderate nuclear positivity in cells in a subset of renal tubules.
Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Emx1 Antibody [NBP1-86500] - Staining of mouse embryo E11 shows moderate nuclear positivity in neuronal cells in developing cortex.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
EMX2 Antibody
AF6470
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF Membrane was probed with 1 µg/mL of Human EMX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6470) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for EMX2 at approximately 33 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
SOX2 Antibody
[Unconjugated]
AF2018
Western blot shows lysates of D3 mouse embryonic stem cell line, NTera‑2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. SOX2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Simple Western lane view shows lysates of BG01V human embryonic stem cells and NTera‑2 human testicular embryonic carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for SOX2 at approximately 53 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(6 Reviews)
(179 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
BMP-4
[Unconjugated]
314-BP/CF
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(459 Publications)
Species: Hu
Applications: BA, BA
SMOX Antibody
NBP3-04509
Immunohistochemistry-Paraffin: SMOX Antibody [NBP3-04509] - Immunohistochemistry of paraffin-embedded mouse testis using SMOX Rabbit pAb (NBP3-04509) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: SMOX Antibody [NBP3-04509] - Western blot analysis of extracts of various cell lines, using SMOX antibody (NBP3-04509) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: SMOX Antibody [NBP3-04509] - Immunohistochemistry of paraffin-embedded rat brain using SMOX Rabbit pAb (NBP3-04509) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
FGF-10
[Unconjugated]
345-FG/CF
1 μg/lane of Recombinant Human FGF-10 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 21 kDa.
Recombinant Human FGF-10 (Catalog # 345-FG/CF) stimulates cell proliferation of the 4MBr‑5 rhesus monkey epithelial cell line. The ED50 for this effect is 20‑100 ng/mL.
(81 Publications)
Species: Hu
Applications: BA
CHX10 Antibody
NBP1-84476
Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human retina shows strong nuclear positivity in inner nuclear layer.
Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
Western Blot: CHX10 Antibody [NBP1-84476] - Analysis in control (vector only transfected HEK293T lysate) and vSX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(5 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TBX5 Antibody
NBP1-83237
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human lung shows moderate nuclear positivity in a subset of pneumocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
VAX1 Antibody (2F4)
H00011023-M03
VAX1 Antibody (2F4)
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA

Publications for VAX1 Antibody (H00011023-M03) (0)

There are no publications for VAX1 Antibody (H00011023-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for VAX1 Antibody (H00011023-M03) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00011023-M03:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence VAX1 H00011023-M03
Enlarge 		3
reviewed by:
Verified Customer
 IF Mouse 12/17/2013
View

Summary

ApplicationImmunofluorescence
Sample TestedPrimary mouse cells
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAX1 Antibody (H00011023-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VAX1 Products

Bioinformatics Tool for VAX1 Antibody (H00011023-M03)

Discover related pathways, diseases and genes to VAX1 Antibody (H00011023-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAX1 Antibody (H00011023-M03)

Discover more about diseases related to VAX1 Antibody (H00011023-M03).
 

Pathways for VAX1 Antibody (H00011023-M03)

View related products by pathway.

PTMs for VAX1 Antibody (H00011023-M03)

Learn more about PTMs related to VAX1 Antibody (H00011023-M03).
 

Research Areas for VAX1 Antibody (H00011023-M03)

Find related products by research area.

Blogs on VAX1

There are no specific blogs for VAX1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0
Immunofluorescence VAX1 H00011023-M03
Enlarge
 Verified Customer
12/17/2013
Application: IF
Species: Mouse
read this review

Bioinformatics

Gene Symbol VAX1
Entrez
Uniprot