VAX1 Antibody (2F4)

Images

 
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in PC-12 (Cat # L012V1).
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in HepG2 (Cat # L019V1).
Western Blot: VAX1 Antibody (2F4) [H00011023-M03] - Analysis of VAX1 expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: VAX1 Antibody (2F4) [H00011023-M03] - Detection limit for recombinant GST tagged VAX1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VAX1 Antibody (2F4) Summary

Immunogen
VAX1 (NP_954582.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRP
Specificity
Reacts with ventral anterior homeobox 1.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VAX1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00011023-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VAX1 Antibody (2F4)

  • MGC126743
  • MGC126745
  • ventral anterior homeobox 1

Background

This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
NBP2-15161
Species: Hu
Applications: ICC/IF, WB
1845-SH/CF
Species: Hu
Applications: BA
AF1979
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-56467
Species: Ca, Hu, Pm
Applications: WB
AF3364
Species: Hu
Applications: ICC, IHC, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
1109-N1/CF
Species: Mu
Applications: Bind
NBP1-31259
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-06699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-86500
Species: Hu, Mu
Applications: IHC, IHC-P
AF6470
Species: Hu, Mu
Applications: WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
345-FG/CF
Species: Hu
Applications: BA
NBP1-84476
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83237
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00011023-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA

Publications for VAX1 Antibody (H00011023-M03) (0)

There are no publications for VAX1 Antibody (H00011023-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for VAX1 Antibody (H00011023-M03) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00011023-M03:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence VAX1 H00011023-M03
Enlarge
3
reviewed by:
Verified Customer
IF Mouse 12/17/2013
View

Summary

ApplicationImmunofluorescence
Sample TestedPrimary mouse cells
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAX1 Antibody (H00011023-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VAX1 Products

Bioinformatics Tool for VAX1 Antibody (H00011023-M03)

Discover related pathways, diseases and genes to VAX1 Antibody (H00011023-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAX1 Antibody (H00011023-M03)

Discover more about diseases related to VAX1 Antibody (H00011023-M03).
 

Pathways for VAX1 Antibody (H00011023-M03)

View related products by pathway.

PTMs for VAX1 Antibody (H00011023-M03)

Learn more about PTMs related to VAX1 Antibody (H00011023-M03).
 

Research Areas for VAX1 Antibody (H00011023-M03)

Find related products by research area.

Blogs on VAX1

There are no specific blogs for VAX1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Verified Customer
12/17/2013
Application: IF
Species: Mouse

Bioinformatics

Gene Symbol VAX1
Entrez
Uniprot