Vasohibin Antibody

Images

 
Western Blot: Vasohibin Antibody [NBP1-52934] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vasohibin Antibody Summary

Immunogen
Synthetic peptides corresponding to VASH1(vasohibin 1) The peptide sequence was selected from the N terminal of VASH1. Peptide sequence ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VASH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against VASH1 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Vasohibin Antibody

  • KIAA1036
  • KIAA1036vasohibin-1
  • VASH
  • VASH1
  • vasohibin 1
  • Vasohibin

Background

VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P

Publications for Vasohibin Antibody (NBP1-52934) (0)

There are no publications for Vasohibin Antibody (NBP1-52934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vasohibin Antibody (NBP1-52934) (0)

There are no reviews for Vasohibin Antibody (NBP1-52934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vasohibin Antibody (NBP1-52934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Vasohibin Products

Bioinformatics Tool for Vasohibin Antibody (NBP1-52934)

Discover related pathways, diseases and genes to Vasohibin Antibody (NBP1-52934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vasohibin Antibody (NBP1-52934)

Discover more about diseases related to Vasohibin Antibody (NBP1-52934).
 

Pathways for Vasohibin Antibody (NBP1-52934)

View related products by pathway.

PTMs for Vasohibin Antibody (NBP1-52934)

Learn more about PTMs related to Vasohibin Antibody (NBP1-52934).

Blogs on Vasohibin

There are no specific blogs for Vasohibin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vasohibin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VASH1
Entrez
Uniprot