Recombinant Human UXS1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UXS1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-420 of Human UXS1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS

Protein/Peptide Type
Recombinant Protein
Gene
UXS1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UXS1 Protein

  • FLJ23591
  • SDR6E1
  • short chain dehydrogenase/reductase family 6E, member 12
  • UDP-glucuronate decarboxylase 1UXS-1
  • UDP-glucuronic acid decarboxylase 1
  • UGDEC 4.1.1.35

Background

UDP-glucuronate decarboxylase (UGD; EC 4.1.1.35) catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49892
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-29948
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-84142
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-80641
Species: Hu
Applications: IHC, IHC-P
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02771
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
1705-HH/CF
Species: Hu, Mu
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-81851
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00080146-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for UXS1 Recombinant Protein (H00080146-P01) (0)

There are no publications for UXS1 Recombinant Protein (H00080146-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UXS1 Recombinant Protein (H00080146-P01) (0)

There are no reviews for UXS1 Recombinant Protein (H00080146-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UXS1 Recombinant Protein (H00080146-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UXS1 Products

Bioinformatics Tool for UXS1 Recombinant Protein (H00080146-P01)

Discover related pathways, diseases and genes to UXS1 Recombinant Protein (H00080146-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UXS1 Recombinant Protein (H00080146-P01)

Discover more about diseases related to UXS1 Recombinant Protein (H00080146-P01).
 

Pathways for UXS1 Recombinant Protein (H00080146-P01)

View related products by pathway.

PTMs for UXS1 Recombinant Protein (H00080146-P01)

Learn more about PTMs related to UXS1 Recombinant Protein (H00080146-P01).
 

Research Areas for UXS1 Recombinant Protein (H00080146-P01)

Find related products by research area.

Blogs on UXS1

There are no specific blogs for UXS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UXS1 Antibody
NBP2-20841

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UXS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UXS1