UTP18 Antibody

Images

 
Western Blot: UTP18 Antibody [NBP2-13511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: UTP18 Antibody [NBP2-13511] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: UTP18 Antibody [NBP2-13511] - Staining of human cerebral cortex shows strong nucleolar positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UTP18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKN ASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UTP18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UTP18 Protein (NBP2-13511PEP)
Publications
Read Publication using
NBP2-13511 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%). Human reactivity reported in scientific literature (PMID: 25435373).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UTP18 Antibody

  • CGI-48
  • U3 small nucleolar RNA-associated protein 18 homolog
  • UTP18, small subunit (SSU) processome component, homolog (yeast)
  • WD repeat domain 50
  • WD repeat-containing protein 50
  • WDR50

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38364
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-46343
Species: Hu
Applications: WB, IHC
NBP2-55739
Species: Hu
Applications: ICC/IF
NBP2-30966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56986
Species: Hu
Applications: WB, ICC/IF
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02575
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92481
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-19562
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-58128
Species: Hu
Applications: ICC/IF
NBP2-59475
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57365
Species: Hu
Applications: WB

Publications for UTP18 Antibody (NBP2-13511)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 4 applications: ICC/IF, IHC, IP, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UTP18 Antibody (NBP2-13511) (0)

There are no reviews for UTP18 Antibody (NBP2-13511). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UTP18 Antibody (NBP2-13511) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UTP18 Products

Bioinformatics Tool for UTP18 Antibody (NBP2-13511)

Discover related pathways, diseases and genes to UTP18 Antibody (NBP2-13511). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for UTP18 Antibody (NBP2-13511)

View related products by pathway.

Research Areas for UTP18 Antibody (NBP2-13511)

Find related products by research area.

Blogs on UTP18

There are no specific blogs for UTP18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTP18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTP18