UTP18 Antibody - BSA Free

Western Blot: UTP18 Antibody [NBP2-13511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: UTP18 Antibody [NBP2-13511] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: UTP18 Antibody [NBP2-13511] - Staining of human cerebral cortex shows strong nucleolar positivity in neurons.

Immunocytochemistry/Immunofluorescence: UTP18 Antibody [NBP2-13511] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UTP18 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UTP18
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UTP18 Protein (NBP2-13511PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Human reactivity reported in scientific literature (PMID: 25435373).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UTP18 Antibody - BSA Free

• CGI-48
• U3 small nucleolar RNA-associated protein 18 homolog
• UTP18, small subunit (SSU) processome component, homolog (yeast)
• WD repeat domain 50
• WD repeat-containing protein 50
• WDR50

Background

UTP18/WDR50 is a component of the small-subunit (SSU) processome, a large ribonucleoprotein complex that participates in ribosomal RNA processing and ribosome assembly. UTP18/WDR50 is a member of the WD repeat family. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UTP18 Antibody (NBP2-13511)(1)

Publication using NBP2-13511

• H W Yang, T-M Kim, S S Song et al. A small subunit processome protein promotes cancer by altering translation. Oncogene 2014-12-01 [PMID: 25435373] (WB, IP, ICC/IF, IF/IHC, Human)

Bioinformatics

• Gene Symbol: UTP18